Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Induction of mucosal and systemic antibody specific for SeMF3 of Streptococcus equi by intranasal vaccination using a sucrose acetate isobutyrate base...

    ID: 1499611

    Description: epitope description:TKELADKLSNAEASRDK antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Equus ...

    Publication: 11027813;

  2. Induction of mucosal and systemic antibody specific for SeMF3 of Streptococcus equi by intranasal vaccination using a sucrose acetate isobutyrate base...

    ID: 1499613

    Description: epitope description:ASRDKAFAVSKDLADKL antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Equus ...

    Publication: 11027813;

  3. Induction of mucosal and systemic antibody specific for SeMF3 of Streptococcus equi by intranasal vaccination using a sucrose acetate isobutyrate base...

    ID: 1499617

    Description: epitope description:DKAFAVSKDLADKLAAK antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Equus ...

    Publication: 11027813;

  4. Induction of mucosal and systemic antibody specific for SeMF3 of Streptococcus equi by intranasal vaccination using a sucrose acetate isobutyrate base...

    ID: 1499620

    Description: epitope description:AEAEKLMENVGSLDRLV antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Equus ...

    Publication: 11027813;

  5. Induction of mucosal and systemic antibody specific for SeMF3 of Streptococcus equi by intranasal vaccination using a sucrose acetate isobutyrate base...

    ID: 1499624

    Description: epitope description:AQKLAEIDQLTADKAKA antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Equus ...

    Publication: 11027813;

  6. Immunogenicity of polymerizable synthetic peptides derived from a vaccine candidate against schistosomiasis: the asparaginyl endopeptidase (Sm32).

    ID: 1499714

    Description: epitope description:RTLDQQYKEVKRETDLSHVQ antigen name:Hemoglobinase (C13 family) host organism:Mus musculus C57BL/6

    Publication: 12941479;

  7. Immunogenicity of polymerizable synthetic peptides derived from a vaccine candidate against schistosomiasis: the asparaginyl endopeptidase (Sm32).

    ID: 1499723

    Description: epitope description:FLKVLKGDKSAGGKVLKSGK antigen name:Hemoglobinase (C13 family) host organism:Mus musculus Swiss

    Publication: 12941479;

  8. Immunogenicity of polymerizable synthetic peptides derived from a vaccine candidate against schistosomiasis: the asparaginyl endopeptidase (Sm32).

    ID: 1499726

    Description: epitope description:DIAYNLMNPFLGKLFNDYNH antigen name:Hemoglobinase (C13 family) host organism:Mus musculus Swiss

    Publication: 12941479;

  9. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499734

    Description: epitope description:KAACPTMGEAHNDKRADPAF antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  10. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499736

    Description: epitope description:VCRQGVVDRGWGNGCGLFGK antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  11. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499742

    Description: epitope description:TVWRNRETLMEFEEPHATKQ antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  12. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499745

    Description: epitope description:VLIELEPPFGDSYIVVGRGE antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  13. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499770

    Description: epitope description:LNLPWSSAGSTVWRNRETLM antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  14. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499775

    Description: epitope description:SSVASLNDLTPVGRLVTVNP antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  15. A peptide domain on gingipain R which confers immunity against Porphyromonas gingivalis infection in mice.

    ID: 1499781

    Description: epitope description:YTPVEEKQNGRMIVIVAKKY antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c

    Publication: 9712755;

  16. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499785

    Description: epitope description:FNCLGMSNRDFLEGVSGATW antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  17. A peptide domain on gingipain R which confers immunity against Porphyromonas gingivalis infection in mice.

    ID: 1499800

    Description: epitope description:QLPFIFDVACVNGDFLFSMPCFAEALMRAQ antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c

    Publication: 9712755;

  18. Structural basis for the binding of the neutralizing antibody, 7D11, to the poxvirus L1 protein.

    ID: 1499808

    Description: epitope description:N27, Q31, T32, K33, D35, S58, A59, D60, A61, D62, K125, K127 antigen name:Protein L1 host organism:Mus musculus antibody name:7D11

    Publication: 17688903;

  19. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499814

    Description: epitope description:FNCLGMSNRDFLEGVSGATW antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  20. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499828

    Description: epitope description:GEYGEVTVDCEPRSGIDTNA antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston