Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Analysis of human antibody epitopes on the 65-kilodalton protein of Mycobacterium leprae by using synthetic peptides.

    ID: 1351736

    Description: epitope description:GGGVTLLQAAPALDKLKLTGDEATGANI antigen name:UniProt:B8ZUA4 host organism:Mus musculus antibody name:2404, 1723

    Publication: 2478477;

  2. Specific and randomly derived immunoactive peptide mimotopes of mycobacterial antigens.

    ID: 1351748

    Description: epitope description:MSPRATI host organism:Mus musculus antibody name:CS-35

    Publication: 16916959;

  3. Specific and randomly derived immunoactive peptide mimotopes of mycobacterial antigens.

    ID: 1351753

    Description: epitope description:SHRLLQTYWSSA host organism:Mus musculus antibody name:CS-35

    Publication: 16916959;

  4. Specific and randomly derived immunoactive peptide mimotopes of mycobacterial antigens.

    ID: 1351766

    Description: epitope description:NLTDILP host organism:Oryctolagus cuniculus antibody name:R1, R2, R3

    Publication: 16916959;

  5. Specific and randomly derived immunoactive peptide mimotopes of mycobacterial antigens.

    ID: 1351771

    Description: epitope description:AVQGFNW host organism:Oryctolagus cuniculus antibody name:R1, R2, R3

    Publication: 16916959;

  6. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351779

    Description: epitope description:DAWREGEEFVVEFDLPGIKA antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  7. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351780

    Description: epitope description:PGIKADSLDIDIERNVVTVR antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 1706384;

  8. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351781

    Description: epitope description:PGIKADSLDIDIERNVVTVR antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  9. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351783

    Description: epitope description:VVTVRAERPGVDPDREMLAA antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  10. Specific and randomly derived immunoactive peptide mimotopes of mycobacterial antigens.

    ID: 1351790

    Description: epitope description:SHRLLQTYWSSA host organism:Oryctolagus cuniculus antibody name:R1, R2, R3

    Publication: 16916959;

  11. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351798

    Description: epitope description:EQVLGTSARPAVMPMDAWRE antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  12. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351805

    Description: epitope description:VVTVRAERPGVDPDREMLAA antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 1706384;

  13. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351806

    Description: epitope description:VVTVRAERPGVDPDREMLAA antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  14. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351811

    Description: epitope description:AKPRKISVDRGNNGHQTINK antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 1706384;

  15. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351814

    Description: epitope description:QTINKTAHEIIDA antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  16. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351822

    Description: epitope description:EMLAAERPRGVFNRQLVLGE antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 1706384;

  17. Characterisation of the binding sites of monoclonal antibodies reacting with the Plasmodium falciparum rhoptry protein RhopH3.

    ID: 1347379

    Description: epitope description:LEEAEGTSNLKKGLEFYKSSLKLDQLDKEKPKKKKSKRKKKRD antigen name:RhopH3 host organism:Mus musculus antibody name:95, 96

    Publication: 9106189;

  18. Characterisation of the binding sites of monoclonal antibodies reacting with the Plasmodium falciparum rhoptry protein RhopH3.

    ID: 1347382

    Description: epitope description:SSLKLDQLDKEKPKKKKSKRKKKRDSSSDRILLEESKTFTSENEL antigen name:RhopH3 host organism:Mus musculus antibody name:95

    Publication: 9106189;

  19. Characterisation of the binding sites of monoclonal antibodies reacting with the Plasmodium falciparum rhoptry protein RhopH3.

    ID: 1347387

    Description: epitope description:QGEDKTTDNTYKEMEE antigen name:RhopH3 host organism:Mus musculus BALB/c

    Publication: 9106189;

  20. Binding of low concentration of peptide to H-2Kd produced in insect cells requires mouse beta 2-microglobulin co-expression.

    ID: 1347401

    Description: epitope description:VMVHDPHSLA antigen name:H-2 class I histocompatibility antigen, K-B alpha chain host organism:Oryctolagus cuniculus New Zealand Wh...

    Publication: 1622899;

  21. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347411

    Description: epitope description:PESNSLTG antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  22. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347415

    Description: epitope description:SLTGLIYA antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  23. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347416

    Description: epitope description:LTGLIYAH antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  24. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347418

    Description: epitope description:GLIYAHTA antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  25. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347422

    Description: epitope description:AHTAHVHK antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  26. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347423

    Description: epitope description:HTAHVHKL antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  27. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347439

    Description: epitope description:NHFSSADE antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  28. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347446

    Description: epitope description:ELIKYLEK antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  29. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347453

    Description: epitope description:KTNINTLE antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  30. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347454

    Description: epitope description:TNINTLEN antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  31. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347456

    Description: epitope description:INTLENSD antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  32. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347460

    Description: epitope description:ENSDHTCF antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  33. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347465

    Description: epitope description:TCFARAVT antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  34. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347472

    Description: epitope description:TLYLFYYY antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  35. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347486

    Description: epitope description:MLSTDDYQ antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  36. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347494

    Description: epitope description:SFFKNKFK antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  37. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347495

    Description: epitope description:FFKNKFKD antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  38. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347501

    Description: epitope description:KDINPLFI antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  39. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347503

    Description: epitope description:INPLFIND antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  40. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347506

    Description: epitope description:LFINDFIL antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  41. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347507

    Description: epitope description:FINDFILI antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  42. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347513

    Description: epitope description:LILNDKKF antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  43. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347517

    Description: epitope description:DKKFMENL antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  44. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347521

    Description: epitope description:MENLDLYI antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  45. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347527

    Description: epitope description:YIMKESER antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  46. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347533

    Description: epitope description:EREHLVIK antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  47. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347536

    Description: epitope description:HLVIKKNP antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  48. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347539

    Description: epitope description:IKKNPFLR antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  49. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347541

    Description: epitope description:KNPFLRVL antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  50. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347542

    Description: epitope description:NPFLRVLN antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston