Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1493756

    Description: epitope description:QREDPTEKGLDFKLYWTDSQNKKEVISSDN antigen name:Protective antigen host organism:Mus musculus Swiss Webster

    Publication: 18480236;

  2. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1493764

    Description: epitope description:SLAGERTWAETMGLNTADTAR antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 18480236;

  3. Immunogenicity of Bacillus anthracis protective antigen domains and efficacy of elicited antibody responses depend on host genetic background.

    ID: 1493766

    Description: epitope description:LNAQDDFSSTPITMNYNQFL antigen name:Protective antigen host organism:Mus musculus C57BL/6

    Publication: 18480236;

  4. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493768

    Description: epitope description:AITCGQVTSSLAPCI antigen name:Other Malus domestica (apple tree) protein host organism:Oryctolagus cuniculus

    Publication: 18036340;

  5. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493778

    Description: epitope description:SIPNGTYR antigen name:UniProt:H6MQD5 host organism:Homo sapiens

    Publication: 8698467;

  6. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493783

    Description: epitope description:GTYRATYQ antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  7. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1493785

    Description: epitope description:QDADYHRV antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  8. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493788

    Description: epitope description:VTSSLAPCIGYVRSG antigen name:Other Malus domestica (apple tree) protein host organism:Oryctolagus cuniculus

    Publication: 18036340;

  9. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493789

    Description: epitope description:VTSSLAPCIGYVRSG antigen name:Other Malus domestica (apple tree) protein host organism:Homo sapiens

    Publication: 18036340;

  10. Lipid transfer proteins from Rosaceae fruits share consensus epitopes responsible for their IgE-binding cross-reactivity.

    ID: 1493797

    Description: epitope description:RSGGAVPPACCNGIR antigen name:Other Malus domestica (apple tree) protein host organism:Homo sapiens

    Publication: 18036340;

  11. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501476

    Description: epitope description:SQDRHKQKIIAPAKQLL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7693508;

  12. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501484

    Description: epitope description:LLVRMKRAELYCPRP antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  13. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501485

    Description: epitope description:FVKIQNLNPIHVIDLMQTHQHGL antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  14. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501496

    Description: epitope description:SQDRHKQKIIAPAKQLL antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  15. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501500

    Description: epitope description:PNGAPEAAL antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  16. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501504

    Description: epitope description:SQDRHKQKIIAPAKQLL antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  17. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501506

    Description: epitope description:FVKIQNLNPIHVIDLMQTHQHGL antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  18. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1501508

    Description: epitope description:PNGAPEAAL antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 7693508;

  19. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501566

    Description: epitope description:TAGEGIVIYGVDTGIDIGHADFGGRAEWGTN antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;

  20. Molecular and structural analysis of immunoglobulin E-binding epitopes of Pen ch 13, an alkaline serine protease major allergen from Penicillium chrys...

    ID: 1501573

    Description: epitope description:QDASNSSPASAPNVCTIAASTNSDGSASFTNFGSVVDLY antigen name:Pen ch 13 host organism:Homo sapiens

    Publication: 15663570;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston