Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

ID: 1502620

Description: epitope description:LILALYDFHGRDVDGFAQGTRTAAIVETVAR antigen name:capsid VP2 host organism:Gallus gallus Leghorn

Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

ID: 1502621

Description: epitope description:QGTRTAAIVETVARMFPDFRSEVSEKFGIDLAVSEE antigen name:capsid VP2 host organism:Gallus gallus Leghorn

Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

ID: 1502622

Description: epitope description:ETVARMFPDFRSEVSEKFGIDLAVSEESDELFVKKTMVSSFS antigen name:capsid VP2 host organism:Gallus gallus Leghorn

Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

ID: 1502631

Description: epitope description:RCDLYPDGNLWGMPCPTY host organism:Mus musculus antibody name:2F2

Identification of antigenic regions on VP2 of African horsesickness virus serotype 3 by using phage-displayed epitope libraries.

ID: 1502632

Description: epitope description:NCNPLEKWCPTVEQTPWY host organism:Mus musculus antibody name:2F2

Production of mouse monoclonal antibodies against Helicobacter pylori Catalase and mapping the antigenic epitope by phage display library.

ID: 1502648

Description: epitope description:NHNDFRPMYTWR host organism:Mus musculus BALB/c antibody name:mAb C001

Production of mouse monoclonal antibodies against Helicobacter pylori Catalase and mapping the antigenic epitope by phage display library.

ID: 1502649

Description: epitope description:HYDFSIKETSLQ host organism:Mus musculus BALB/c antibody name:mAb C001

Characterisation of new monoclonal antibodies reacting with prions from both human and animal brain tissues.

ID: 1502847

Description: epitope description:MKHM antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus C57BL/6 antibody name:3F4

Hydropathic complementarity determines interaction of epitope (869)HITDTNNK(876) in Manduca sexta Bt-R(1) receptor with loop 2 of domain II of Bacillu...

ID: 1502912

Description: epitope description:RRPFNIGINNQQ antigen name:Other Bacillus thuringiensis protein host organism:Homo sapiens antibody name:scFv73

Characterisation of new monoclonal antibodies reacting with prions from both human and animal brain tissues.

ID: 1502917

Description: epitope description:YQRESQAYYQRGA antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Rb486

Molecular basis for Bacillus thuringiensis Cry1Ab toxin specificity: two structural determinants in the Manduca sexta Bt-R1 receptor interact with loo...

ID: 1502935

Description: epitope description:RRPFNIGINNQQ antigen name:Other Bacillus thuringiensis protein host organism:Homo sapiens antibody name:scFv73

Use of Luminex xMAP-derived Bio-Plex bead-based suspension array for specific detection of PPV W and characterization of epitopes on the coat protein ...

ID: 1502937

Description: epitope description:DEEDD antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2C3, 10G7

IgE-binding epitopes of the American cockroach Per a 3 allergen.

ID: 1502957

Description: epitope description:IPKGKKGGQAY antigen name:Per a 3 host organism:Homo sapiens

Th1 and Th2 indices of the immune response in pigs vaccinated against Taenia solium cysticercosis suggest various host immune strategies against the p...

ID: 1502988

Description: epitope description:GYYYPSDPNTFFYAPPYSA host organism:Sus scrofa antibody name:anti-S3Pvac

High affinity mimotope of the polysaccharide capsule of Cryptococcus neoformans identified from an evolutionary phage peptide library.

ID: 1502997

Description: epitope description:FGGETFTPDWMMEVAIDNE host organism:Mus musculus BALB/c antibody name:mAb 2H1

Ultrastructural localization and epitope mapping of the methyltransferase-like and helicase-like proteins of Beet yellows virus.

ID: 1503000

Description: epitope description:SRLLENET antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:4A5, 4A2

Construction and functional activities of chimeric mouse-human immunoglobulin G and immunoglobulin M antibodies against the Neisseria meningitidis Por...

ID: 1503005

Description: epitope description:DTNNN antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:151,F-9; 184,F-12

Construction and functional activities of chimeric mouse-human immunoglobulin G and immunoglobulin M antibodies against the Neisseria meningitidis Por...

ID: 1503007

Description: epitope description:DTNNN antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:151,F-9; 184,F-12

Ultrastructural localization and epitope mapping of the methyltransferase-like and helicase-like proteins of Beet yellows virus.

ID: 1503008

Description: epitope description:DDPF antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:1C4

Monoclonal antibodies against the adeno-associated virus type 2 (AAV-2) capsid: epitope mapping and identification of capsid domains involved in AAV-2...

ID: 1503021

Description: epitope description:KRVLEPLGL antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:A1