Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465635

    Description: epitope description:PGGPDRFTLLTPGSH antigen name:Amb a 3 host organism:Oryctolagus cuniculus antibody name:anti-Ra3

    Publication: 2420608;

  2. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465636

    Description: epitope description:TPGSHFIATKDQKFV host organism:Oryctolagus cuniculus antibody name:anti-Ra3

    Publication: 2420608;

  3. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465638

    Description: epitope description:TPGSHFIATKDQKFV host organism:Mus musculus Outbred antibody name:anti-Ra3

    Publication: 2420608;

  4. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465639

    Description: epitope description:DQKFVAAVPGR host organism:Homo sapiens antibody name:human sera

    Publication: 2420608;

  5. Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.

    ID: 1465642

    Description: epitope description:SVTFELLFDGTSPLTEEMGDDFGFGLCPYDTSPVV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:b13

    Publication: 7691986;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston