Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Monoclonal antibodies against the adeno-associated virus type 2 (AAV-2) capsid: epitope mapping and identification of capsid domains involved in AAV-2...

    ID: 1503024

    Description: epitope description:LNFGQTGDADSV antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:A69

    Publication: 10982375;

  2. Monoclonal antibodies against the adeno-associated virus type 2 (AAV-2) capsid: epitope mapping and identification of capsid domains involved in AAV-2...

    ID: 1503038

    Description: epitope description:SADNNNSEYSWT antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:C37-B

    Publication: 10982375;

  3. Monoclonal antibodies against the adeno-associated virus type 2 (AAV-2) capsid: epitope mapping and identification of capsid domains involved in AAV-2...

    ID: 1503039

    Description: epitope description:SADNNNSEYSWT antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:C37-B

    Publication: 10982375;

  4. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503050

    Description: epitope description:GVGSSAVILDDNFVT antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  5. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503051

    Description: epitope description:FTIDYFQPNNKRNQL antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  6. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503052

    Description: epitope description:VDHVGLGTAFENSIY antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  7. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503054

    Description: epitope description:TSNQRGVGSTVVILD antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  8. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503058

    Description: epitope description:GVGSSAVILDDNFVT antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  9. Identification of an immunorelevant ORF2 epitope from porcine circovirus type 2 as a serological marker for experimental and natural infection.

    ID: 1503065

    Description: epitope description:GVGSSAVILDDNFVT antigen name:Capsid protein host organism:Sus scrofa

    Publication: 11504425;

  10. The effect of amino acid spacers on the antigenicity of dimeric peptide--inducing cross-reacting antibodies to a cell surface protein antigen of Strep...

    ID: 1503114

    Description: epitope description:TYEAALKQYEADL antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 11169138;

  11. Ultrastructural localization and epitope mapping of the methyltransferase-like and helicase-like proteins of Beet yellows virus.

    ID: 1503130

    Description: epitope description:TMVTPGEL antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:3C5, 4B4, 4C5

    Publication: 11458006;

  12. Ultrastructural localization and epitope mapping of the methyltransferase-like and helicase-like proteins of Beet yellows virus.

    ID: 1503132

    Description: epitope description:SREQLVEA antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:2A4

    Publication: 11458006;

  13. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503138

    Description: epitope description:FQNLQNHRIVQ antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  14. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503141

    Description: epitope description:IEAKPNTLVL antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  15. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503144

    Description: epitope description:VIQQGQA antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  16. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503149

    Description: epitope description:RVAKISMPVNTPGQF antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  17. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503153

    Description: epitope description:EIRRVLLEENAG antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  18. Determination of pepsin-susceptible and pepsin-resistant epitopes in native and heat-treated peanut allergen Ara h 1.

    ID: 1503178

    Description: epitope description:LFEVKPDKKNPQLQD antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 18298062;

  19. Characterization of Norwalk virus GI specific monoclonal antibodies generated against Escherichia coli expressed capsid protein and the reactivity of ...

    ID: 1503355

    Description: epitope description:MMMASKDATSSVDGASGAGQLVPEVNTSDPLAMDPVAGSSTAV host organism:Mus musculus BALB/c antibody name:3E7, 4E6, 4F7, 7D2, 13F9, 1G9, 3D10, 4...

    Publication: 11710959;

  20. Characterization of Norwalk virus GI specific monoclonal antibodies generated against Escherichia coli expressed capsid protein and the reactivity of ...

    ID: 1503359

    Description: epitope description:GTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQ antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody nam...

    Publication: 11710959;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston