Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.

    ID: 1465643

    Description: epitope description:SVTFELLFDGTSPLTEEMGDDFGFGLCPYDTSPVVKGKYNTTLLNGSA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:b...

    Publication: 7691986;

  2. Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.

    ID: 1465644

    Description: epitope description:CKEDHRYAISTTNEIGLHGAEGLT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:b6, b1, b5, b8

    Publication: 7691986;

  3. Characterization of rubella virus-specific antibody responses by using a new synthetic peptide-based enzyme-linked immunosorbent assay.

    ID: 1465647

    Description: epitope description:NQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Homo sapiens

    Publication: 1629342;

  4. Envelope proteins of human T cell leukemia virus type I: characterization by antisera to synthetic peptides and identification of a natural epitope.

    ID: 1465651

    Description: epitope description:QYAAQNRRGLDLL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2428880;

  5. Envelope proteins of human T cell leukemia virus type I: characterization by antisera to synthetic peptides and identification of a natural epitope.

    ID: 1465656

    Description: epitope description:QYAAQNRRGLDLL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2428880;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston