Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1465658

Description: epitope description:KEARDQEMN antigen name:envelope polyprotein host organism:Mus musculus BALB/c antibody name:mAb 86

Molecular mimicry by Mycoplasma pneumoniae to evade the induction of adherence inhibiting antibodies.

ID: 1473111

Description: epitope description:PFNQWPDY antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Acute patient sera

IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

ID: 1473224

Description: epitope description:TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLD antigen name:Der p 1 host organism:Homo sapiens antibody name:patient ser...

IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

ID: 1473226

Description: epitope description:TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLD antigen name:Der p 1 host organism:Oryctolagus cuniculus antibody name:hy...

IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

ID: 1473238

Description: epitope description:LAQPQRYCRHYWTIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWI antigen name:Der p 1 host organism:Oryctolagus cuniculus antibody name:h...