Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Vaccination with prion peptide-displaying papillomavirus-like particles induces autoantibodies to normal prion protein that interfere with pathologic ...

    ID: 1370146

    Description: epitope description:DWEDRYYRE antigen name:Major prion protein host organism:Rattus norvegicus Lewis

    Publication: 17313482;

  2. Identification of new immunogenic peptides in conserved regions of hepatitis C virus (HCV) 1b with the potentiality to generate cytotoxic T lymphocyte...

    ID: 1370185

    Description: epitope description:VYHGAGSKTL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17362301;

  3. Identification of new immunogenic peptides in conserved regions of hepatitis C virus (HCV) 1b with the potentiality to generate cytotoxic T lymphocyte...

    ID: 1370188

    Description: epitope description:RYAPACKPL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17362301;

  4. Species-specificity of a panel of prion protein antibodies for the immunohistochemical study of animal and human prion diseases.

    ID: 1370208

    Description: epitope description:DWEDRYYRE antigen name:Major prion protein host organism:Mus musculus antibody name:143

    Publication: 17270205;

  5. A single prion protein peptide can elicit a panel of isoform specific monoclonal antibodies.

    ID: 1370322

    Description: epitope description:CITQYERESQAYY antigen name:Major prion protein host organism:Mus musculus BALB/c

    Publication: 16859811;

  6. Protective and immunochemical activities of monoclonal antibodies reactive with the Bacillus anthracis polypeptide capsule.

    ID: 1370356

    Description: epitope description:EEEEE + D-aa(1, 2, 3, 4, 5) antigen name:Other Bacillus anthracis (anthrax bacterium) protein host organism:Mus musculus BALB/c an...

    Publication: 17060470;

  7. Immunological characterization of abnormal prion protein from atypical scrapie cases in sheep using a panel of monoclonal antibodies.

    ID: 1370396

    Description: epitope description:GWGQPHGGGWGQPHGGGWGQPHGGGWGQPHG antigen name:Major prion protein host organism:Mus musculus antibody name:SAF32 and SAF34

    Publication: 17098989;

  8. Immunological characterization of abnormal prion protein from atypical scrapie cases in sheep using a panel of monoclonal antibodies.

    ID: 1370400

    Description: epitope description:WGQGGSHSQW antigen name:Major prion protein host organism:Mus musculus antibody name:ICSM35

    Publication: 17098989;

  9. Immunological characterization of abnormal prion protein from atypical scrapie cases in sheep using a panel of monoclonal antibodies.

    ID: 1370406

    Description: epitope description:YEDRYYRENM antigen name:Major prion protein host organism:Mus musculus antibody name:6H4

    Publication: 17098989;

  10. Immunological characterization of abnormal prion protein from atypical scrapie cases in sheep using a panel of monoclonal antibodies.

    ID: 1370408

    Description: epitope description:YQRESQAYYQRGAS antigen name:Major prion protein host organism:Rattus norvegicus antibody name:R145

    Publication: 17098989;

  11. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370442

    Description: epitope description:YISPYFINTS antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Mus musculus BALB/c antibody name:...

    Publication: 17301219;

  12. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370448

    Description: epitope description:RFDKGYISGY antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:CRP-8

    Publication: 17301219;

  13. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370473

    Description: epitope description:TVLARSIAKE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  14. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370475

    Description: epitope description:EIIEQLDVTT antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  15. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370477

    Description: epitope description:AVTMGPKGRT antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  16. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370479

    Description: epitope description:SWGSPKVTKD antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  17. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370496

    Description: epitope description:YVLLSEKKIS antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  18. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370498

    Description: epitope description:SIQSIVPALE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  19. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370505

    Description: epitope description:LKVGGTSDVE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  20. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370514

    Description: epitope description:EVGYDAMAGD antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  21. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370516

    Description: epitope description:ASLLTTAEVV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  22. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370517

    Description: epitope description:TAEVVVTEIP antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  23. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370528

    Description: epitope description:NRKNQLKDMA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  24. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370554

    Description: epitope description:ATISANGDKE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  25. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370558

    Description: epitope description:IIEGMKFDRG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  26. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370560

    Description: epitope description:KGQKCEFQDA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  27. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370568

    Description: epitope description:GCALLRCIPA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  28. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370569

    Description: epitope description:RCIPALDSLT antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  29. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1370571

    Description: epitope description:AKNAGVEGSL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 17301219;

  30. Common peptide epitope in mumps virus nucleocapsid protein and MHC class II-associated invariant chain.

    ID: 1370596

    Description: epitope description:YQQQGRL antigen name:Mumps rubulavirus protein host organism:Homo sapiens

    Publication: 7683440;

  31. A synthetic peptide-based polyoxime vaccine construct of high purity and activity.

    ID: 1370632

    Description: epitope description:PKYVKQNTLKLATGMRNVPEKQT antigen name:Hemagglutinin host organism:Mus musculus antibody name:1/1

    Publication: 8544852;

  32. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370738

    Description: epitope description:YESNHLIDLSRYASKINIG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

    Publication: 9488054;

  33. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370743

    Description: epitope description:KNQIQLFNLESSKIEVILK antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

    Publication: 9488054;

  34. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370753

    Description: epitope description:GEIIWTLQDTQEIKQRVVF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

    Publication: 9488054;

  35. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370756

    Description: epitope description:DYINRWIFVTITNNRLNNS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

    Publication: 9488054;

  36. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370761

    Description: epitope description:DQKPISNLGNIHASNNIMF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

    Publication: 9488054;

  37. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370768

    Description: epitope description:NSGILKDFWGDYLQYDKPY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

    Publication: 9488054;

  38. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370773

    Description: epitope description:KYVDVNNVGIRGYMYLKGP antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

    Publication: 9488054;

  39. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370774

    Description: epitope description:YLKGPRGSVMTTNIYLNSS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

    Publication: 9488054;

  40. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370775

    Description: epitope description:YLKGPRGSVMTTNIYLNSS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

    Publication: 9488054;

  41. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370778

    Description: epitope description:KKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

    Publication: 9488054;

  42. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370779

    Description: epitope description:KKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

    Publication: 9488054;

  43. Determination of the fine epitope specificity of an anti-hepatitis B virus X protein monoclonal antibody using microanalytical and molecular biologica...

    ID: 1356922

    Description: epitope description:DRNIYLVRQ host organism:Mus musculus antibody name:3F6-G10

    Publication: 12943796;

  44. A new form of particulate single and multiple immunogen delivery system based on recombinant bluetongue virus-derived tubules.

    ID: 1361307

    Description: epitope description:ATGWQTIDGKKYYFNTNTAEAATGWQTIDGKKYYFNTNTAIAST antigen name:Toxin A host organism:Oryctolagus cuniculus

    Publication: 8599217;

  45. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361355

    Description: epitope description:ALANVYDLPDDFFP antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  46. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361362

    Description: epitope description:KIDDLVRDAKDALE antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  47. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361371

    Description: epitope description:IKKHVLIATHFVDL antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  48. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361372

    Description: epitope description:ATHFVDLIEDFWQT antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  49. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361373

    Description: epitope description:ATHFVDLIEDFWQT antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  50. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361377

    Description: epitope description:IEDFWQTTQGMHEI antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston