Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Fine specificity of antibodies against AQP4: epitope mapping reveals intracellular epitopes.

    ID: 1830991

    Description: epitope description:SCDSKRTDVTGSIA antigen name:Aquaporin-4 host organism:Homo sapiens

    Publication: 21333492;

  2. Fine specificity of antibodies against AQP4: epitope mapping reveals intracellular epitopes.

    ID: 1830995

    Description: epitope description:FCPDVEFKRRFKEAFSKAAQQTKG antigen name:Aquaporin-4 host organism:Homo sapiens

    Publication: 21333492;

  3. Fine specificity of antibodies against AQP4: epitope mapping reveals intracellular epitopes.

    ID: 1830997

    Description: epitope description:KAAQQTKGSYMEVEDNRSQVETDD antigen name:Aquaporin-4 host organism:Homo sapiens

    Publication: 21333492;

  4. Fine specificity of antibodies against AQP4: epitope mapping reveals intracellular epitopes.

    ID: 1830999

    Description: epitope description:RSQVETDDLILKPGVVHVIDVDRG antigen name:Aquaporin-4 host organism:Homo sapiens

    Publication: 21333492;

  5. Fine specificity of antibodies against AQP4: epitope mapping reveals intracellular epitopes.

    ID: 1831002

    Description: epitope description:HVIDVDRGEEKKGKDQSGEVLSSV antigen name:Aquaporin-4 host organism:Homo sapiens

    Publication: 21333492;

  6. Fine specificity of antibodies against AQP4: epitope mapping reveals intracellular epitopes.

    ID: 1831006

    Description: epitope description:FGHISGGHINPAVTVAMVCTRKISIA antigen name:Aquaporin-4 host organism:Homo sapiens

    Publication: 21333492;

  7. Identification of mono- or poly-specific monoclonal antibody to Porphyromonas gingivalis heat-shock protein 60.

    ID: 1831013

    Description: epitope description:TLVVNRLRGSLKICAVKAPG antigen name:60 kDa chaperonin host organism:Mus musculus C57BL/6 antibody name:JC5, JC6, JC7, JC8, JC9

    Publication: 21556254;

  8. Inhibition of MT-450 rat mammary tumour growth by antibodies recognising subtypes of blood group antigen B.

    ID: 1831037

    Description: epitope description:alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal antigen name:N-glycoprotein host organism:Mus musculus C57BL/6 X BALB/c antibod...

    Publication: 10442639;

  9. Identification of the shortest Abeta-peptide generating highly specific antibodies against the C-terminal end of amyloid-beta42.

    ID: 1831055

    Description: epitope description:GGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus C57BL/6

    Publication: 21371581;

  10. CD4+ T cells mediate the protective effect of the recombinant Asp f3-based anti-aspergillosis vaccine.

    ID: 1831094

    Description: epitope description:DKKVILFALPGAFTPVCSAR antigen name:Asp f 3 host organism:Mus musculus CF-1

    Publication: 21422177;

  11. CD4+ T cells mediate the protective effect of the recombinant Asp f3-based anti-aspergillosis vaccine.

    ID: 1831095

    Description: epitope description:VCSARHVPEYIEKLPEIRAK antigen name:Asp f 3 host organism:Mus musculus CF-1

    Publication: 21422177;

  12. CD4+ T cells mediate the protective effect of the recombinant Asp f3-based anti-aspergillosis vaccine.

    ID: 1831101

    Description: epitope description:EPAKNHLEFSSAETVLKHL antigen name:Asp f 3 host organism:Mus musculus CF-1

    Publication: 21422177;

  13. N-Acetylated domains in heparan sulfates revealed by a monoclonal antibody against the Escherichia coli K5 capsular polysaccharide. Distribution of th...

    ID: 1831109

    Description: epitope description:[4)-D-GlcpA-(1->4)-D-GlcpNAc-(1->]n host organism:Mus musculus BALB/c antibody name:mAb 865

    Publication: 8798457;

  14. Identification and characterization of novel B-cell epitopes within EBV latent membrane protein 2 (LMP2).

    ID: 1831129

    Description: epitope description:KSLSSTEFIPN antigen name:Latent membrane protein 2 host organism:Homo sapiens

    Publication: 21668364;

  15. Identification and characterization of novel B-cell epitopes within EBV latent membrane protein 2 (LMP2).

    ID: 1831134

    Description: epitope description:RIEDPPFNSLL antigen name:Latent membrane protein 2 host organism:Mus musculus BALB/c

    Publication: 21668364;

  16. Identification of mono- or poly-specific monoclonal antibody to Porphyromonas gingivalis heat-shock protein 60.

    ID: 1831156

    Description: epitope description:TVPGGGTTYIRAIAALEGLK antigen name:60 kDa chaperonin host organism:Mus musculus C57BL/6 antibody name:JC1, JC2, JC3

    Publication: 21556254;

  17. Alloreactive monoclonal antibodies select Kd molecules with different peptide profiles.

    ID: 1831160

    Description: epitope description:R97 antigen name:Beta-2-microglobulin host organism:Mus musculus B10.STC77 antibody name:F35.119.18

    Publication: 8805645;

  18. Mapping the binding between the tetraspanin molecule (Sjc23) of Schistosoma japonicum and human non-immune IgG.

    ID: 1831167

    Description: epitope description:YKDKIDDEINTLMTGALEN antigen name:Schistosoma japonicum protein host organism:Homo sapiens

    Publication: 21533061;

  19. Mapping the binding between the tetraspanin molecule (Sjc23) of Schistosoma japonicum and human non-immune IgG.

    ID: 1831177

    Description: epitope description:KIQTSFHCCGVKGPDDYKG antigen name:Schistosoma japonicum protein host organism:Homo sapiens

    Publication: 21533061;

  20. A synthetic multi-epitope antigen enhances hepatitis C virus-specific B- and T-cell responses.

    ID: 1831204

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21449721;

  21. Passive (amyloid-beta) immunotherapy attenuates monoaminergic axonal degeneration in the AbetaPPswe/PS1dE9 mice.

    ID: 1831223

    Description: epitope description:DAEFRHDSGYE antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 20966549;

  22. Epitope selection to male specific antigens for sex selection in swine.

    ID: 1831248

    Description: epitope description:PTEGTGDWSSEEPEEEQEETG antigen name:Male-enhanced antigen 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21397337;

  23. Characterization of porcine kidney neutral glycosphingolipids: identification of a carbohydrate antigen recognized by human natural antibodies.

    ID: 1831274

    Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp host organism:Mus musculus antibody name:Anti-A mouse monoclonal antibody

    Publication: 7841803;

  24. Characterization of porcine kidney neutral glycosphingolipids: identification of a carbohydrate antigen recognized by human natural antibodies.

    ID: 1831277

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens antibody name:Anti-Gal

    Publication: 7841803;

  25. N-Propionylated group B meningococcal polysaccharide mimics a unique bactericidal capsular epitope in group B Neisseria meningitidis.

    ID: 1831278

    Description: epitope description:[8)-alpha-Neu5Pr-(2->]14 host organism:Mus musculus BALB/c

    Publication: 9166422;

  26. Epitope selection to male specific antigens for sex selection in swine.

    ID: 1831301

    Description: epitope description:TRSRALERRRRRQKVDQGRNVEN antigen name:Lysine-specific demethylase 5D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21397337;

  27. Epitope selection to male specific antigens for sex selection in swine.

    ID: 1831302

    Description: epitope description:EMESHSVTQAGVQWPDLGSLEV antigen name:ATP-dependent RNA helicase DDX3Y host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21397337;

  28. Epitope selection to male specific antigens for sex selection in swine.

    ID: 1831305

    Description: epitope description:AHPREKKTSKSSKIRSLADYR antigen name:Golgin subfamily A member 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21397337;

  29. Epitope selection to male specific antigens for sex selection in swine.

    ID: 1831308

    Description: epitope description:RKWLEEQLKQYRVKRQQERSSQ antigen name:Golgin subfamily A member 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21397337;

  30. N-Propionylated group B meningococcal polysaccharide mimics a unique bactericidal capsular epitope in group B Neisseria meningitidis.

    ID: 1831425

    Description: epitope description:[8)-alpha-Neu5Pr-(2->]5 host organism:Mus musculus BALB/c antibody name:6B9

    Publication: 9166422;

  31. N-Propionylated group B meningococcal polysaccharide mimics a unique bactericidal capsular epitope in group B Neisseria meningitidis.

    ID: 1831426

    Description: epitope description:[8)-alpha-Neu5Pr-(2->]4 host organism:Mus musculus BALB/c antibody name:10B9, 7C11, 11G1, 1F1, 11F3

    Publication: 9166422;

  32. Neutralization of West Nile virus by cross-linking of its surface proteins with Fab fragments of the human monoclonal antibody CR4354.

    ID: 1831442

    Description: epitope description:Chain A: N47, E49, A51, N52, E133, N134, I135, K136, Y137, E138, F167, S168: Chain B: K310, F311, L312, Q328, N368, K370 antigen n...

    Publication: 20956322;

  33. Characterization of an epitope (determinant) structure in a developmentally regulated glycolipid antigen defined by a cold agglutinin Fl, recognition ...

    ID: 1831458

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNA...

    Publication: 6194883;

  34. Characterization of an epitope (determinant) structure in a developmentally regulated glycolipid antigen defined by a cold agglutinin Fl, recognition ...

    ID: 1831461

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)]-beta-D-Gal...

    Publication: 6194883;

  35. Characterization of an epitope (determinant) structure in a developmentally regulated glycolipid antigen defined by a cold agglutinin Fl, recognition ...

    ID: 1831462

    Description: epitope description:alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)]-beta-D-Gal-(...

    Publication: 6194883;

  36. Characterization of an epitope (determinant) structure in a developmentally regulated glycolipid antigen defined by a cold agglutinin Fl, recognition ...

    ID: 1831464

    Description: epitope description:beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[alpha-L-Fuc-(1->2)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-beta-D-GlcNAc...

    Publication: 6194883;

  37. A novel HPV 16 L1-based chimeric virus-like particle containing E6 and E7 seroreactive epitopes permits highly specific detection of antibodies in pat...

    ID: 1831468

    Description: epitope description:TLGIVCPI antigen name:Protein E7 host organism:Homo sapiens

    Publication: 21306638;

  38. Immunogenic characterization and epitope mapping of transmissible gastroenteritis virus RNA dependent RNA polymerase.

    ID: 1831480

    Description: epitope description:FFENKD antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:3F9, 2B5

    Publication: 21513742;

  39. Localization of epitopes recognized by monoclonal antibodies that neutralized the H3N2 influenza viruses in man.

    ID: 1831515

    Description: epitope description:N204, Q205, E206, T208, V212 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F033-161, F003-003, F003-137, F00...

    Publication: 21068214;

  40. Localization of epitopes recognized by monoclonal antibodies that neutralized the H3N2 influenza viruses in man.

    ID: 1831539

    Description: epitope description:K82, E83 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F008-057, F020-043, F032-067

    Publication: 21068214;

  41. Localization of epitopes recognized by monoclonal antibodies that neutralized the H3N2 influenza viruses in man.

    ID: 1831540

    Description: epitope description:R50, D53 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F020-121, F019-103, F019-105, F020-019, F020-029, F02...

    Publication: 21068214;

  42. Localization of epitopes recognized by monoclonal antibodies that neutralized the H3N2 influenza viruses in man.

    ID: 1831543

    Description: epitope description:R50, D53, S54 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F038-353

    Publication: 21068214;

  43. Localization of epitopes recognized by monoclonal antibodies that neutralized the H3N2 influenza viruses in man.

    ID: 1831544

    Description: epitope description:E82, K83 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F019-102, F019-117, F019-120, F041-278, F041-310, F04...

    Publication: 21068214;

  44. Epitope mapping and structural analysis of the anti-Der p 1 monoclonal antibody: insight into therapeutic potential.

    ID: 1831607

    Description: epitope description:QSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAR antigen name:Der p 1 host organism:Homo sapiens

    Publication: 21567139;

  45. Epitope mapping and structural analysis of the anti-Der p 1 monoclonal antibody: insight into therapeutic potential.

    ID: 1831609

    Description: epitope description:VRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL antigen name:Der p 1 host organism:Homo sapiens

    Publication: 21567139;

  46. Localization of epitopes recognized by monoclonal antibodies that neutralized the H3N2 influenza viruses in man.

    ID: 1831622

    Description: epitope description:A131, T135, Y137 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F010-001, F010-073

    Publication: 21068214;

  47. Structural basis for the preferential recognition of immature flaviviruses by a fusion-loop antibody.

    ID: 1831632

    Description: epitope description:T76, G106 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:E53

    Publication: 19713934;

  48. Antibodies against ganglioside GT3 in the sera of patients with type I diabetes mellitus.

    ID: 1831643

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 2654294;

  49. A cyclic undecamer peptide mimics a turn in folded Alzheimer amyloid beta and elicits antibodies against oligomeric and fibrillar amyloid and plaques.

    ID: 1831665

    Description: epitope description:EDVGSNK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 21526148;

  50. Tyrosine-phosphorylated Ehrlichia chaffeensis and Ehrlichia canis tandem repeat orthologs contain a major continuous cross-reactive antibody epitope i...

    ID: 1847974

    Description: epitope description:KKIKEYDEDYTITYYYDDD antigen name:Other Ehrlichia canis protein host organism:Canis lupus familiaris

    Publication: 21606187;

  51. Novel immunogenic peptides elicit systemic anaphylaxis in mice: implications for peptide vaccines.

    ID: 1847978

    Description: epitope description:DWPALIFDQDML host organism:Mus musculus MF1

    Publication: 21709154;

  52. Novel immunogenic peptides elicit systemic anaphylaxis in mice: implications for peptide vaccines.

    ID: 1847979

    Description: epitope description:WEWDWPRIELNI host organism:Mus musculus MF1

    Publication: 21709154;

  53. Tyrosine-phosphorylated Ehrlichia chaffeensis and Ehrlichia canis tandem repeat orthologs contain a major continuous cross-reactive antibody epitope i...

    ID: 1847985

    Description: epitope description:DDSKLPVIKVEDKSKLQDTKDKKR antigen name:Other Ehrlichia canis protein host organism:Oryctolagus cuniculus

    Publication: 21606187;

  54. Novel immunogenic peptides elicit systemic anaphylaxis in mice: implications for peptide vaccines.

    ID: 1847990

    Description: epitope description:WGPRVIFEDVTV host organism:Mus musculus MF1

    Publication: 21709154;

  55. Anti-myelin associated glycoprotein antibodies recognize HNK-1 epitope on CNS.

    ID: 1848026

    Description: epitope description:HNK-1 carbohydrate antigen name:Myelin-associated glycoprotein host organism:Mus musculus antibody name:HNK-1

    Publication: 21621858;

  56. Ceramide glycosylation and fatty acid hydroxylation influence serological reactivity in Trypanosoma cruzi glycosphingolipids.

    ID: 1848111

    Description: epitope description:beta-D-glucosyl-N-(docosanoyl)sphingosine host organism:Oryctolagus cuniculus

    Publication: 15727820;

  57. Structural basis of immune evasion at the site of CD4 attachment on HIV-1 gp120.

    ID: 1848128

    Description: epitope description:I108, W111, V251, A277, S360, G361, G362, D363, E365, I366, S370, F377, Y379, K408, M413, E416, G460, D461, M462, R463 antigen nam...

    Publication: 19965434;

  58. Structural basis of immune evasion at the site of CD4 attachment on HIV-1 gp120.

    ID: 1848131

    Description: epitope description:A281, T283, S365, G366, G367, D368, P369, E370, I371, V372, T373, Y384, R419, K421, N425, M426, G473, D474 antigen name:Envelope g...

    Publication: 19965434;

  59. A mimotope peptide of Abeta42 fibril-specific antibodies with Abeta42 fibrillation inhibitory activity induces anti-Abeta42 conformer antibody respons...

    ID: 1848143

    Description: epitope description:SSIIDILLPPIY host organism:Homo sapiens antibody name:D1 scFv

    Publication: 21641049;

  60. A mimotope peptide of Abeta42 fibril-specific antibodies with Abeta42 fibrillation inhibitory activity induces anti-Abeta42 conformer antibody respons...

    ID: 1848151

    Description: epitope description:CQGHLPWMC host organism:Homo sapiens antibody name:B7 scFv

    Publication: 21641049;

  61. A mimotope peptide of Abeta42 fibril-specific antibodies with Abeta42 fibrillation inhibitory activity induces anti-Abeta42 conformer antibody respons...

    ID: 1848154

    Description: epitope description:CYGSLPWMC host organism:Homo sapiens antibody name:B7 scFv

    Publication: 21641049;

  62. A mimotope peptide of Abeta42 fibril-specific antibodies with Abeta42 fibrillation inhibitory activity induces anti-Abeta42 conformer antibody respons...

    ID: 1848157

    Description: epitope description:CYGTEPWMC host organism:Homo sapiens antibody name:D1 scFv

    Publication: 21641049;

  63. Structural basis of immune evasion at the site of CD4 attachment on HIV-1 gp120.

    ID: 1848163

    Description: epitope description:A281, T283, S365, G366, G367, D368, P369, E370, I371, V372, T373, Y384, R419, K421, N425, M426, G473, D474 antigen name:Envelope g...

    Publication: 19965434;

  64. Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.

    ID: 1848175

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S2...

    Publication: 18272175;

  65. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 1848215

    Description: epitope description:MSDNGPQSNQRSAPRI antigen name:Nucleoprotein host organism:Mus musculus BALB/c

    Publication: 15528730;

  66. Carrier-bound, nonallergenic Ole e 1 peptides for vaccination against olive pollen allergy.

    ID: 1848221

    Description: epitope description:LVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 21513971;

  67. B cell epitopes of gliadin.

    ID: 1848223

    Description: epitope description:QVPLVQEQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 10931138;

  68. Immunodiagnostically applicable monoclonal antibodies to the circulating anodic antigen of Schistosoma mansoni bind to small, defined oligosaccharide ...

    ID: 1848276

    Description: epitope description:beta-D-GalpNAc-(1->6)-[beta-D-GlcpA-(1->3)]-beta-D-GalpNAc-(1->6)-[beta-D-GlcpA-(1->3)]-beta-D-GalpNAc antigen name:proteoglycan h...

    Publication: 12695908;

  69. Immunodiagnostically applicable monoclonal antibodies to the circulating anodic antigen of Schistosoma mansoni bind to small, defined oligosaccharide ...

    ID: 1848281

    Description: epitope description:beta-D-GalpNAc-(1->6)-[beta-D-GlcpA-(1->3)]-beta-D-GalpNAc-(1->6)-[beta-D-GlcpA-(1->3)]-beta-D-GalpNAc antigen name:proteoglycan h...

    Publication: 12695908;

  70. O-methylated glycans from Toxocara are specific targets for antibody binding in human and animal infections.

    ID: 1848300

    Description: epitope description:alpha-L-Fucp2Me-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc antigen name:O-glycan host organism:Bos taurus

    Publication: 17087964;

  71. O-methylated glycans from Toxocara are specific targets for antibody binding in human and animal infections.

    ID: 1848303

    Description: epitope description:alpha-L-Fucp2Me-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc antigen name:O-glycan host organism:Oryctolagus cuniculus

    Publication: 17087964;

  72. O-methylated glycans from Toxocara are specific targets for antibody binding in human and animal infections.

    ID: 1848319

    Description: epitope description:alpha-L-Fucp2Me-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc antigen name:O-glycan host organism:Oryctolagus cuniculus

    Publication: 17087964;

  73. O-methylated glycans from Toxocara are specific targets for antibody binding in human and animal infections.

    ID: 1848326

    Description: epitope description:alpha-L-Fucp2Me-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc antigen name:O-glycan host organism:Homo sapiens

    Publication: 17087964;

  74. O-methylated glycans from Toxocara are specific targets for antibody binding in human and animal infections.

    ID: 1848333

    Description: epitope description:alpha-L-Fucp2Me-(1->2)-beta-D-Galp4Me antigen name:O-glycan host organism:Mus musculus BALB/c

    Publication: 17087964;

  75. O-methylated glycans from Toxocara are specific targets for antibody binding in human and animal infections.

    ID: 1848338

    Description: epitope description:alpha-L-Fucp2Me-(1->2)-beta-D-Galp4Me antigen name:O-glycan host organism:Homo sapiens

    Publication: 17087964;

  76. O-methylated glycans from Toxocara are specific targets for antibody binding in human and animal infections.

    ID: 1848340

    Description: epitope description:alpha-L-Fucp2Me-(1->2)-beta-D-Galp4Me antigen name:O-glycan host organism:Bos taurus

    Publication: 17087964;

  77. O-methylated glycans from Toxocara are specific targets for antibody binding in human and animal infections.

    ID: 1848344

    Description: epitope description:alpha-L-Fucp2Me-(1->2)-beta-D-Galp4Me antigen name:O-glycan host organism:Mus musculus BALB/c

    Publication: 17087964;

  78. O-methylated glycans from Toxocara are specific targets for antibody binding in human and animal infections.

    ID: 1848352

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GalpNAc host organism:Mus musculus BALB/c

    Publication: 17087964;

  79. Frequencies of lipopolysaccharide-defined epitopes in Haemophilus influenzae type b and non-typable isolates determined with monoclonal antibodies.

    ID: 1848387

    Description: epitope description:L-glycero-alpha-D-manno-Hepp-(1->2)-L-glycero-alpha-D-manno-Hepp-(1->3)-L-glycero-alpha-D-manno-Hepp-(1->5)-alpha-Kdo antigen name...

    Publication: 11856281;

  80. Frequencies of lipopolysaccharide-defined epitopes in Haemophilus influenzae type b and non-typable isolates determined with monoclonal antibodies.

    ID: 1848388

    Description: epitope description:alpha-D-Galp-(1->4)-beta-D-Galp antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:MAHI 6

    Publication: 11856281;

  81. Identification of critical amino acids in the IgE epitopes of Ric c 1 and Ric c 3 and the application of glutamic acid as an IgE blocker.

    ID: 1848441

    Description: epitope description:EGLRQAIEQQQSQGQ antigen name:Sweet protein mabinlin-1 chain A host organism:Homo sapiens

    Publication: 21738671;

  82. Identification of critical amino acids in the IgE epitopes of Ric c 1 and Ric c 3 and the application of glutamic acid as an IgE blocker.

    ID: 1848443

    Description: epitope description:QEVQRKDLSSCERYL antigen name:Sweet protein mabinlin-1 chain A host organism:Homo sapiens

    Publication: 21738671;

  83. A novel GlcNAcalpha1-HPO3-6Gal(1-1)ceramide antigen and alkylated inositol-phosphoglycerolipids expressed by the liver fluke Fasciola hepatica.

    ID: 1848455

    Description: epitope description:N-acetyl-alpha-D-glucosamine 1-phosphate antigen name:alpha-D-GlcpNAc-(1-P-6)-D-Glcp-(1<->1')-Cer host organism:Oryctolagus cunicu...

    Publication: 12626405;

  84. A peptide inhibitor of HIV-1 neutralizing antibody 2G12 is not a structural mimic of the natural carbohydrate epitope on gp120.

    ID: 1848475

    Description: epitope description:ACPPSHVLDMRSGTCLAAEGK + AMID(K21) host organism:Oryctolagus cuniculus

    Publication: 18198210;

  85. Crystal structure of HIV-1 reverse transcriptase in complex with a polypurine tract RNA:DNA.

    ID: 1848480

    Description: epitope description:R199, Q222, K223, E224, P225, P226, F227, W229, M230 antigen name:Gag-Pol polyprotein host organism:Mus musculus BALB/c antibody n...

    Publication: 11250910;

  86. Identification of two antigenic epitopes on SARS-CoV spike protein.

    ID: 1848545

    Description: epitope description:PDPLKPTKRSF antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15184071;

  87. Identification of two antigenic epitopes on SARS-CoV spike protein.

    ID: 1848547

    Description: epitope description:KLRPFERDI antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:D3D1

    Publication: 15184071;

  88. The common Cryptococcus neoformans glucuronoxylomannan M2 motif elicits non-protective antibodies.

    ID: 1848593

    Description: epitope description:beta-D-GlcpA-(1->2)-alpha-D-Manp6Ac-(1->3)-[beta-D-Xylp-(1->2)]-alpha-D-Manp-(1->3)-[beta-D-Xylp-(1->2)]-alpha-D-Manp-(1->3)-alpha...

    Publication: 19464529;

  89. Fertility-disrupting potential of synthetic peptides derived from the beta-subunit of follicle-stimulating hormone.

    ID: 1848604

    Description: epitope description:YTRDLVYK antigen name:Follitropin subunit beta host organism:Rattus norvegicus Sprague-Dawley

    Publication: 9764364;

  90. Structural definition of a conserved neutralization epitope on HIV-1 gp120.

    ID: 1848621

    Description: epitope description:N280, A281, S365, G366, G367, D368, P369, I371, V372, T373, Y384, N386, P417, R419, V430, G431, K432, T455, R456, G472, G473, D474...

    Publication: 17301785;

  91. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848813

    Description: epitope description:SPSAAE antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15543570;

  92. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848830

    Description: epitope description:YLENATQ host organism:Sus scrofa

    Publication: 15543570;

  93. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848838

    Description: epitope description:TFGNRTQ host organism:Sus scrofa

    Publication: 15543570;

  94. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848848

    Description: epitope description:SITNPTQ host organism:Sus scrofa

    Publication: 15543570;

  95. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848853

    Description: epitope description:NPTQIRR host organism:Sus scrofa

    Publication: 15543570;

  96. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848861

    Description: epitope description:FQINPTQ host organism:Sus scrofa

    Publication: 15543570;

  97. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848867

    Description: epitope description:LGPNHTQ host organism:Sus scrofa

    Publication: 15543570;

  98. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848874

    Description: epitope description:YLPNVTQ host organism:Sus scrofa

    Publication: 15543570;

  99. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848875

    Description: epitope description:HLPNATQ host organism:Sus scrofa

    Publication: 15543570;

  100. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848877

    Description: epitope description:NITQEAF host organism:Sus scrofa

    Publication: 15543570;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston