Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361378

    Description: epitope description:TQGMHEIAESLRAV antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  2. Fine mapping of virus-neutralizing epitopes on hepatitis B virus PreS1.

    ID: 1356928

    Description: epitope description:NTANPDWDF antigen name:Large envelope protein host organism:Mus musculus antibody name:KR359

    Publication: 10772975;

  3. Immunogenicity of viral B-cell epitopes inserted into two surface loops of the Escherichia coli K12 LamB protein and expressed in an attenuated aroA s...

    ID: 1356944

    Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 10078601;

  4. HBV infection of cell culture: evidence for multivalent and cooperative attachment.

    ID: 1357015

    Description: epitope description:DPAF antigen name:Large envelope protein host organism:Mus musculus antibody name:mAb 18/7

    Publication: 11500372;

  5. Comparative antigenicity and immunogenicity of hepadnavirus core proteins.

    ID: 1357114

    Description: epitope description:NANPNANPNANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus

    Publication: 16227284;

  6. Effect of variation in the common ""a"" determinant on the antigenicity of hepatitis B surface antigen.

    ID: 1357332

    Description: epitope description:P142, G145 antigen name:Large envelope protein host organism:Cavia porcellus antibody name:AUSRIA kit antibody

    Publication: 10596008;

  7. Effect of variation in the common ""a"" determinant on the antigenicity of hepatitis B surface antigen.

    ID: 1357333

    Description: epitope description:G145 antigen name:Large envelope protein host organism:Mus musculus antibody name:RFHBs 1, 7, 18

    Publication: 10596008;

  8. Characterization of complex B cell epitopes on woodchuck hepatitis virus surface antigens by using plasmids encoding chimeric proteins and DNA immuniz...

    ID: 1357357

    Description: epitope description:CRQCTISYQDMYTPPYCCCLKPTAGNC antigen name:Large envelope protein host organism:Capra hircus

    Publication: 12009876;

  9. Characterization of complex B cell epitopes on woodchuck hepatitis virus surface antigens by using plasmids encoding chimeric proteins and DNA immuniz...

    ID: 1357392

    Description: epitope description:TLSPAVPTVSTILS antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 12009876;

  10. Characterization of complex B cell epitopes on woodchuck hepatitis virus surface antigens by using plasmids encoding chimeric proteins and DNA immuniz...

    ID: 1357412

    Description: epitope description:MKNQTFHLQGFVDGL antigen name:Large envelope protein host organism:Mus musculus antibody name:WHs2.1

    Publication: 12009876;

  11. Hepatitis delta antigen. Antigenic structure and humoral immune response.

    ID: 1357491

    Description: epitope description:GEGAPPAKRARTDQME antigen name:Small delta antigen host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2479687;

  12. Hepatitis delta antigen. Antigenic structure and humoral immune response.

    ID: 1357504

    Description: epitope description:SRGAPGGGFVPSLQGVP antigen name:Small delta antigen host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2479687;

  13. Expression and immunoactivity of chimeric particulate antigens of receptor binding site-core antigen of hepatitis B virus.

    ID: 1360221

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 15641132;

  14. Hepatitis delta antigen. Antigenic structure and humoral immune response.

    ID: 1360250

    Description: epitope description:GEGAPPAKRARTDQME antigen name:Small delta antigen host organism:Homo sapiens

    Publication: 2479687;

  15. Hepatitis delta antigen. Antigenic structure and humoral immune response.

    ID: 1360268

    Description: epitope description:TDQMEVDSGPRKRPLRGG antigen name:Small delta antigen host organism:Marmota monax

    Publication: 2479687;

  16. Hypervariable region IV of Salmonella gene fliCd encodes a dominant surface epitope and a stabilizing factor for functional flagella.

    ID: 1360293

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNS antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 7512552;

  17. Hepatitis B virus e antigen specific epitopes and limitations of commercial anti-HBe immunoassays.

    ID: 1360338

    Description: epitope description:YVNTNMGLKIRQ antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 10630956;

  18. Hepatitis B virus e antigen specific epitopes and limitations of commercial anti-HBe immunoassays.

    ID: 1360343

    Description: epitope description:CSPHHTALRQ antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 10630956;

  19. Fine mapping of neutralization epitopes on duck hepatitis B virus (DHBV) pre-S protein using monoclonal antibodies and overlapping peptides.

    ID: 1360709

    Description: epitope description:NPTPQEIPQPQWTPEEDQKAREAF antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:24A4, 15B2

    Publication: 7685963;

  20. Anti-HBs after hepatitis B immunization with plasma-derived and recombinant DNA-derived vaccines: binding to mutant HBsAg.

    ID: 1360831

    Description: epitope description:STTTSTGPCKTCTTPAQGNSMFPSC antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 11395201;

  21. Fine mapping of neutralization epitopes on duck hepatitis B virus (DHBV) pre-S protein using monoclonal antibodies and overlapping peptides.

    ID: 1360833

    Description: epitope description:NPTPQEIPQPQWTPEEDQKAREAF antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:24A4, 15B2, 5

    Publication: 7685963;

  22. Fine mapping of neutralization epitopes on duck hepatitis B virus (DHBV) pre-S protein using monoclonal antibodies and overlapping peptides.

    ID: 1360866

    Description: epitope description:FRRYQEER antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:SD20

    Publication: 7685963;

  23. Fine mapping of neutralization epitopes on duck hepatitis B virus (DHBV) pre-S protein using monoclonal antibodies and overlapping peptides.

    ID: 1360871

    Description: epitope description:IPQPQWTP antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:900

    Publication: 7685963;

  24. Anti-HBs after hepatitis B immunization with plasma-derived and recombinant DNA-derived vaccines: binding to mutant HBsAg.

    ID: 1360876

    Description: epitope description:PAQGNSMFPSCCCTKPTDANCTCIP host organism:Homo sapiens

    Publication: 11395201;

  25. Anti-HBs after hepatitis B immunization with plasma-derived and recombinant DNA-derived vaccines: binding to mutant HBsAg.

    ID: 1360889

    Description: epitope description:FPSCCCTKPTDKNCTCIPIPSSWAF host organism:Homo sapiens

    Publication: 11395201;

  26. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361382

    Description: epitope description:AESLRAVIPPTTTP antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  27. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361384

    Description: epitope description:IPPTTTPVPPGYLI antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  28. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361388

    Description: epitope description:VPPGYLIQHEEAEE antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  29. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361400

    Description: epitope description:VSFQPDYPITARIH antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  30. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361403

    Description: epitope description:PITARIHAHLKAYA antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  31. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361405

    Description: epitope description:AHLKAYAKINEESL antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  32. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361420

    Description: epitope description:TNYISRLRTWLSTP antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  33. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361431

    Description: epitope description:APTIEAITRPIQVA antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  34. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361452

    Description: epitope description:SRERRAPTPQRAGS antigen name:External core antigen host organism:Anas platyrhynchos

    Publication: 14747559;

  35. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361455

    Description: epitope description:TPQRAGSPLPRSSS antigen name:External core antigen host organism:Anas platyrhynchos

    Publication: 14747559;

  36. Significance of pre-S region-defective hepatitis B virus that emerged during exacerbation of chronic type B hepatitis.

    ID: 1361476

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFN antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 8477960;

  37. Significance of pre-S region-defective hepatitis B virus that emerged during exacerbation of chronic type B hepatitis.

    ID: 1361477

    Description: epitope description:ASTNRQSGRQPTPISPPLRDSHPQ antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 8477960;

  38. Maltodextrin-binding protein hybrids carrying epitopes from the preS2 region of hepatitis B virus: expression, antibody-binding and preliminary crysta...

    ID: 1361485

    Description: epitope description:QDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus antibody name:mAb S2.3

    Publication: 9089817;

  39. Fine and domain-level epitope mapping of botulinum neurotoxin type A neutralizing antibodies by yeast surface display.

    ID: 1368116

    Description: epitope description:Q1254, F1255, N1256 antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:S25

    Publication: 17059824;

  40. 48-mer synthetic peptide analogue of the hepatitis B virus ""a"" determinant induces an anti-HBs antibody response after a single injection.

    ID: 1368135

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 11002244;

  41. 48-mer synthetic peptide analogue of the hepatitis B virus ""a"" determinant induces an anti-HBs antibody response after a single injection.

    ID: 1368142

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 11002244;

  42. 48-mer synthetic peptide analogue of the hepatitis B virus ""a"" determinant induces an anti-HBs antibody response after a single injection.

    ID: 1368150

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 11002244;

  43. Identification of hepatitis A virus mimotopes by phage display, antigenicity and immunogenicity.

    ID: 1368151

    Description: epitope description:SHSAFNMFDFGVGPP host organism:Homo sapiens antibody name:anti-HAV

    Publication: 17129616;

  44. Identification of hepatitis A virus mimotopes by phage display, antigenicity and immunogenicity.

    ID: 1368152

    Description: epitope description:SHSVTKSLRVFGGPP host organism:Homo sapiens antibody name:anti-HAV

    Publication: 17129616;

  45. 48-mer synthetic peptide analogue of the hepatitis B virus ""a"" determinant induces an anti-HBs antibody response after a single injection.

    ID: 1368161

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Cavia porcellus Duncan-Hartley

    Publication: 11002244;

  46. 48-mer synthetic peptide analogue of the hepatitis B virus ""a"" determinant induces an anti-HBs antibody response after a single injection.

    ID: 1368162

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Cavia porcellus Duncan-Hartley

    Publication: 11002244;

  47. Identification of hepatitis A virus mimotopes by phage display, antigenicity and immunogenicity.

    ID: 1368180

    Description: epitope description:SHSQLGPPVGGPP host organism:Mus musculus BALB/c antibody name:anti-HAV

    Publication: 17129616;

  48. Characterization of an immunodominant antigenic site on GB virus C glycoprotein E2 that is involved in cell binding.

    ID: 1368221

    Description: epitope description:FYEPLVRRC antigen name:Pegivirus C protein host organism:Mus musculus antibody name:M6

    Publication: 17035329;

  49. Characterization of an immunodominant antigenic site on GB virus C glycoprotein E2 that is involved in cell binding.

    ID: 1368225

    Description: epitope description:FYEPLVRRC antigen name:Pegivirus C protein host organism:Mus musculus antibody name:M6

    Publication: 17035329;

  50. A single 10-residue pre-S(1) peptide can prime T cell help for antibody production to multiple epitopes within the pre-S(1), pre-S(2), and S regions o...

    ID: 1368332

    Description: epitope description:PAANQVGVGAFGPRLTPPHGG antigen name:Large envelope protein host organism:Mus musculus

    Publication: 2438344;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston