Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Immunization with a peptide derived from the G glycoprotein of bovine respiratory syncytial virus (BRSV) reduces the incidence of BRSV-associated pneu...

    ID: 1460307

    Description: epitope description:STCEGNLACLSLSK host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 9302749;

  2. Peptide mimics elicit antibody responses against the outer-membrane lipooligosaccharide of group B neisseria meningitidis.

    ID: 1460348

    Description: epitope description:SMYGSYN host organism:Mus musculus antibody name:9-2-L379

    Publication: 11004398;

  3. Non-anaphylactic surface-exposed peptides of the major birch pollen allergen, Bet v 1, for preventive vaccination.

    ID: 1460372

    Description: epitope description:LFPKVAPQAISSVENIEGNGGPGTIKKISF antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 15479266;

  4. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1460374

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;

  5. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1460385

    Description: epitope description:CCRHKQPLIAPAKQLLPPSASARRGDLAHLAAAHARHPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;

  6. Non-anaphylactic surface-exposed peptides of the major birch pollen allergen, Bet v 1, for preventive vaccination.

    ID: 1460400

    Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Oryctolagus cuniculus

    Publication: 15479266;

  7. Non-anaphylactic surface-exposed peptides of the major birch pollen allergen, Bet v 1, for preventive vaccination.

    ID: 1460402

    Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 15479266;

  8. Non-anaphylactic surface-exposed peptides of the major birch pollen allergen, Bet v 1, for preventive vaccination.

    ID: 1460405

    Description: epitope description:KAEQVKASKEMGETLLRAVESYLLAHSDAYN antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 15479266;

  9. Immunogenicity and in vitro protective efficacy of a polyepitope Plasmodium falciparum candidate vaccine constructed by epitope shuffling.

    ID: 1460794

    Description: epitope description:KNESKYSNTFINNAYNMSIRRSM antigen name:Merozoite surface antigen 2 host organism:Mus musculus BALB/c

    Publication: 17548134;

  10. Immunogenicity and in vitro protective efficacy of a polyepitope Plasmodium falciparum candidate vaccine constructed by epitope shuffling.

    ID: 1460804

    Description: epitope description:KKICKMEKCSSVFNV antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c

    Publication: 17548134;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston