Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848878

    Description: epitope description:SYAAVAS host organism:Sus scrofa

    Publication: 15543570;

  2. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848884

    Description: epitope description:STPRLPD host organism:Sus scrofa

    Publication: 15543570;

  3. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848894

    Description: epitope description:FNVTQGP host organism:Sus scrofa

    Publication: 15543570;

  4. Identification of epitopes in the nucleocapsid protein of Nipah virus using a linear phage-displayed random peptide library.

    ID: 1848896

    Description: epitope description:SIYAAEK host organism:Homo sapiens

    Publication: 15543570;

  5. Structural basis of tyrosine sulfation and VH-gene usage in antibodies that recognize the HIV type 1 coreceptor-binding site on gp120.

    ID: 1848912

    Description: epitope description:C119, V120, L122, T202, Q203, R419, K421, Q422, I423, M434, P437 antigen name:Envelope glycoprotein gp160 host organism:Homo sapie...

    Publication: 14981267;

  6. Localization of carbohydrate determinants common to Biomphalaria glabrata as well as to sporocysts and miracidia of Schistosoma mansoni.

    ID: 1848969

    Description: epitope description:alpha-L-Fuc-(1->3)-beta-D-GalNAc-(1->4)-beta-D-GlcNAc-yl group antigen name:glycoprotein host organism:Mus musculus antibody name:...

    Publication: 18507884;

  7. Localization of carbohydrate determinants common to Biomphalaria glabrata as well as to sporocysts and miracidia of Schistosoma mansoni.

    ID: 1848970

    Description: epitope description:alpha-L-Fuc-(1->3)-beta-D-GalNAc-(1->4)-beta-D-GlcNAc-yl group antigen name:glycoprotein host organism:Mus musculus antibody name:...

    Publication: 18507884;

  8. Localization of carbohydrate determinants common to Biomphalaria glabrata as well as to sporocysts and miracidia of Schistosoma mansoni.

    ID: 1848974

    Description: epitope description:alpha-L-Fuc-(1->3)-beta-D-GalNAc-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-yl group antigen name:glycoprotein host organism:Mus mu...

    Publication: 18507884;

  9. Identification of the smallest structure capable of evoking opsonophagocytic antibodies against Streptococcus pneumoniae type 14.

    ID: 1849210

    Description: epitope description:beta-D-Glcp-(1->6)-beta-D-GlcpNAc-(1->3)-beta-D-Galp antigen name:polysaccharide host organism:Mus musculus BALB/c

    Publication: 18678667;

  10. Identification of the smallest structure capable of evoking opsonophagocytic antibodies against Streptococcus pneumoniae type 14.

    ID: 1849218

    Description: epitope description:beta-D-Glcp-(1->6)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp antigen name:polysaccharide host organism:Mus musculus BAL...

    Publication: 18678667;

  11. Identification of the smallest structure capable of evoking opsonophagocytic antibodies against Streptococcus pneumoniae type 14.

    ID: 1849238

    Description: epitope description:beta-D-Galp-(1->4)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->6)]-beta-D-GlcpNAc antigen name:po...

    Publication: 18678667;

  12. Identification of the smallest structure capable of evoking opsonophagocytic antibodies against Streptococcus pneumoniae type 14.

    ID: 1849247

    Description: epitope description:beta-D-Gal-(1->4)-[beta-D-Gal-(1->4)-[beta-D-Gal-(1->4)-[beta-D-Gal-(1->4)-beta-D-Glc-(1->6)]-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->...

    Publication: 18678667;

  13. Identification of critical amino acids in the IgE epitopes of Ric c 1 and Ric c 3 and the application of glutamic acid as an IgE blocker.

    ID: 1849263

    Description: epitope description:QEVQRKDLSSCERYL antigen name:Sweet protein mabinlin-1 chain A host organism:Homo sapiens

    Publication: 21738671;

  14. Identification of critical amino acids in the IgE epitopes of Ric c 1 and Ric c 3 and the application of glutamic acid as an IgE blocker.

    ID: 1849266

    Description: epitope description:LHGEESERVAQRAGE antigen name:Sweet protein mabinlin-1 chain A host organism:Homo sapiens

    Publication: 21738671;

  15. Identification of critical amino acids in the IgE epitopes of Ric c 1 and Ric c 3 and the application of glutamic acid as an IgE blocker.

    ID: 1849268

    Description: epitope description:ESKGEREGSSSQQCR antigen name:Sweet protein mabinlin-1 chain A host organism:Homo sapiens

    Publication: 21738671;

  16. Identification of critical amino acids in the IgE epitopes of Ric c 1 and Ric c 3 and the application of glutamic acid as an IgE blocker.

    ID: 1849270

    Description: epitope description:QEQQNLRQCQEYIK antigen name:Sweet protein mabinlin-1 chain A host organism:Homo sapiens

    Publication: 21738671;

  17. A novel peptide ELISA for universal detection of antibodies to human H5N1 influenza viruses.

    ID: 1849287

    Description: epitope description:CNTKCQTPMGAINSS antigen name:Hemagglutinin host organism:Gallus gallus Leghorn

    Publication: 21695200;

  18. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849332

    Description: epitope description:WSPSKLYSARDHGGGS host organism:Mus musculus BALB/c antibody name:H12H3

    Publication: 21695105;

  19. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849334

    Description: epitope description:QPNHRDHFKLPAGGGS host organism:Mus musculus BALB/c antibody name:H12H3

    Publication: 21695105;

  20. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849338

    Description: epitope description:SNWRDHYGLGAGGGGS host organism:Mus musculus BALB/c antibody name:H12H3

    Publication: 21695105;

  21. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849340

    Description: epitope description:ACWPSMRDHCGGGS host organism:Mus musculus BALB/c antibody name:H12H3

    Publication: 21695105;

  22. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849358

    Description: epitope description:ACNVYEAYWCGGGS host organism:Mus musculus BALB/c antibody name:H12H3

    Publication: 21695105;

  23. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849360

    Description: epitope description:ACQVPHFFGCGGGS host organism:Mus musculus BALB/c antibody name:H12H3

    Publication: 21695105;

  24. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849362

    Description: epitope description:MDWINPFPNFNSGGGS host organism:Mus musculus BALB/c antibody name:H13F7

    Publication: 21695105;

  25. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849364

    Description: epitope description:TPSWRNPFPTFYGGGS host organism:Mus musculus BALB/c antibody name:H13F7

    Publication: 21695105;

  26. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849379

    Description: epitope description:ALLPFKDHLPYPGGGS host organism:Mus musculus BALB/c antibody name:H12H3

    Publication: 21695105;

  27. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849383

    Description: epitope description:FAENKKDHFSPGGGGS host organism:Mus musculus BALB/c antibody name:H12H3

    Publication: 21695105;

  28. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849384

    Description: epitope description:ACWYSTRDHCGGGS host organism:Mus musculus BALB/c antibody name:H12H3

    Publication: 21695105;

  29. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849386

    Description: epitope description:ACISPNQWLCGGGS host organism:Mus musculus BALB/c antibody name:H12H3

    Publication: 21695105;

  30. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849387

    Description: epitope description:ACLDAKLQQCGGGS host organism:Mus musculus BALB/c antibody name:H12H3

    Publication: 21695105;

  31. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849394

    Description: epitope description:TPTWPLLTIFPSGGGS host organism:Mus musculus BALB/c antibody name:H13F7

    Publication: 21695105;

  32. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849399

    Description: epitope description:NSPFMLHSALSGGGS host organism:Mus musculus BALB/c antibody name:H13F7

    Publication: 21695105;

  33. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849404

    Description: epitope description:APWSLRDHLAVTGGGS host organism:Homo sapiens

    Publication: 21695105;

  34. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849413

    Description: epitope description:ALLPFKDHLPYPGGGS host organism:Homo sapiens

    Publication: 21695105;

  35. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849423

    Description: epitope description:MDWINPFPNFNSGGGS host organism:Homo sapiens

    Publication: 21695105;

  36. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849424

    Description: epitope description:MDWINPFPNFNSGGGS host organism:Homo sapiens

    Publication: 21695105;

  37. Identification of peptide mimotopes of Trypanosoma brucei gambiense variant surface glycoproteins.

    ID: 1849426

    Description: epitope description:QPAIWINPFPAWGGGS host organism:Homo sapiens

    Publication: 21695105;

  38. Glycotope analysis in miracidia and primary sporocysts of Schistosoma mansoni: differential expression during the miracidium-to-sporocyst transformati...

    ID: 1849546

    Description: epitope description:N-acetyl-beta-D-galactosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl group antigen name:glycoprotein host organism:Mus musculus anti...

    Publication: 19545571;

  39. Glycotope analysis in miracidia and primary sporocysts of Schistosoma mansoni: differential expression during the miracidium-to-sporocyst transformati...

    ID: 1849548

    Description: epitope description:alpha-L-Fuc-(1->3)-beta-D-GalNAc-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc-yl group antigen name:glycoprotein host organism:Mus mu...

    Publication: 19545571;

  40. Glycotope analysis in miracidia and primary sporocysts of Schistosoma mansoni: differential expression during the miracidium-to-sporocyst transformati...

    ID: 1849549

    Description: epitope description:N-acetyl-beta-D-galactosaminyl-(1->4)-[alpha-L-fucosyl-(1->3)]-N-acetyl-beta-D-glucosaminyl group antigen name:glycoprotein host o...

    Publication: 19545571;

  41. Doubly branched hexasaccharide epitope on the cell wall polysaccharide of group A streptococci recognized by human and rabbit antisera.

    ID: 1849711

    Description: epitope description:beta-D-GlcpNAc-(1->3)-[alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->2)]-alpha-L-Rhap antigen name:polysaccharide host ...

    Publication: 16177309;

  42. B cell epitopes of gliadin.

    ID: 1844749

    Description: epitope description:VRVPVPQL antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 10931138;

  43. B cell epitopes of gliadin.

    ID: 1844752

    Description: epitope description:IILHQQHH antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 10931138;

  44. Fertility-disrupting potential of synthetic peptides derived from the beta-subunit of follicle-stimulating hormone.

    ID: 1844774

    Description: epitope description:YTRDLVYK antigen name:Follitropin subunit beta host organism:Rattus norvegicus Sprague-Dawley

    Publication: 9764364;

  45. Fertility-disrupting potential of synthetic peptides derived from the beta-subunit of follicle-stimulating hormone.

    ID: 1844779

    Description: epitope description:SFGEMKE antigen name:Follitropin subunit beta host organism:Rattus norvegicus Sprague-Dawley

    Publication: 9764364;

  46. Host-dependent Lewis (Le) antigen expression in Helicobacter pylori cells recovered from Leb-transgenic mice.

    ID: 1844803

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc antigen name:lipopolysaccharide host organism:Mus musc...

    Publication: 20008521;

  47. Mapping of conformational IgE epitopes with peptide-specific monoclonal antibodies reveals simultaneous binding of different IgE antibodies to a surfa...

    ID: 1844816

    Description: epitope description:GPGTIKKISF antigen name:Bet v 1 host organism:Mus musculus BALB/c antibody name:2

    Publication: 21451110;

  48. Mapping of conformational IgE epitopes with peptide-specific monoclonal antibodies reveals simultaneous binding of different IgE antibodies to a surfa...

    ID: 1844824

    Description: epitope description:GGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Mus musculus BALB/c antibody name:mAb12

    Publication: 21451110;

  49. Distinct ACPA fine specificities, formed under the influence of HLA shared epitope alleles, have no effect on radiographic joint damage in rheumatoid ...

    ID: 1844844

    Description: epitope description:GVYATRSSAVRLRSSV + CITR(R6, R11, R13) antigen name:Vimentin host organism:Homo sapiens

    Publication: 21666230;

  50. Localization of epitopes recognized by monoclonal antibodies that neutralized the H3N2 influenza viruses in man.

    ID: 1844860

    Description: epitope description:S235, W238, G241, L242 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F033-161, F003-003, F003-137, F003-147,...

    Publication: 21068214;

  51. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1844863

    Description: epitope description:KCLKFYSKISEYRHY antigen name:Protein E6 host organism:Oryctolagus cuniculus

    Publication: 7507231;

  52. Localization of epitopes recognized by monoclonal antibodies that neutralized the H3N2 influenza viruses in man.

    ID: 1844866

    Description: epitope description:G275, K276, N278 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F008-039, F004-111, F004-144, F008-024, F008-...

    Publication: 21068214;

  53. Amino acid residues 56 to 69 of HLA-A2 specify an antigenic determinant shared by HLA-A2 and HLA-B17.

    ID: 1844873

    Description: epitope description:GPEYWDGETRKVKA antigen name:HLA class I histocompatibility antigen, A-2 alpha chain host organism:Oryctolagus cuniculus New Zealan...

    Publication: 2423602;

  54. Heavy-chain complementarity-determining regions determine conformation selectivity of anti-abeta antibodies.

    ID: 1844904

    Description: epitope description:DAEFGHDSGFEVRHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:mAb158, mAb1C3

    Publication: 20714111;

  55. Carrier-bound, nonallergenic Ole e 1 peptides for vaccination against olive pollen allergy.

    ID: 1844976

    Description: epitope description:EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIP antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 21513971;

  56. Carrier-bound, nonallergenic Ole e 1 peptides for vaccination against olive pollen allergy.

    ID: 1844991

    Description: epitope description:GASLRLQCKDKENGDVTFTEVGYTRAEGLYS antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 21513971;

  57. Carrier-bound, nonallergenic Ole e 1 peptides for vaccination against olive pollen allergy.

    ID: 1845006

    Description: epitope description:MLVERDHKNEFCEITLISSGRKDCNEIPTEGWA antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 21513971;

  58. Specific antibody responses to three schistosome-related carbohydrate structures in recently exposed immigrants and established residents in an area o...

    ID: 1845026

    Description: epitope description:beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp antigen name:proteoglycan host organism:Homo sapien...

    Publication: 14500488;

  59. Amino acid residues 56 to 69 of HLA-A2 specify an antigenic determinant shared by HLA-A2 and HLA-B17.

    ID: 1845034

    Description: epitope description:GPEYWDGETRKVKA antigen name:HLA class I histocompatibility antigen, A-2 alpha chain host organism:Oryctolagus cuniculus New Zealan...

    Publication: 2423602;

  60. Peptides specific for Mycobacterium avium subspecies paratuberculosis infection: diagnostic potential.

    ID: 1845084

    Description: epitope description:KDYQRNRGPSKFTGLQPSVL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21669956;

  61. Peptides specific for Mycobacterium avium subspecies paratuberculosis infection: diagnostic potential.

    ID: 1845089

    Description: epitope description:YVPIVTFYSEISMHSSRAIP host organism:Capra hircus

    Publication: 21669956;

  62. Peptides specific for Mycobacterium avium subspecies paratuberculosis infection: diagnostic potential.

    ID: 1845090

    Description: epitope description:EARHVELCPDFKYYPFFCVP host organism:Capra hircus

    Publication: 21669956;

  63. Mapping of conformational IgE epitopes with peptide-specific monoclonal antibodies reveals simultaneous binding of different IgE antibodies to a surfa...

    ID: 1845095

    Description: epitope description:GGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Mus musculus BALB/c antibody name:mAb12

    Publication: 21451110;

  64. Synthesis of cross-reactive carbohydrate determinants fragments as tools for in vitro allergy diagnosis.

    ID: 1845104

    Description: epitope description:alpha-D-Manp-(1->6)-[beta-D-Xylp-(1->2)]-beta-D-Manp host organism:Oryctolagus cuniculus antibody name:anti-bee venom

    Publication: 21237664;

  65. Mapping of conformational IgE epitopes with peptide-specific monoclonal antibodies reveals simultaneous binding of different IgE antibodies to a surfa...

    ID: 1845110

    Description: epitope description:EVDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Oryctolagus cuniculus

    Publication: 21451110;

  66. Synthesis of cross-reactive carbohydrate determinants fragments as tools for in vitro allergy diagnosis.

    ID: 1845112

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-[beta-D-Xylp-(1->2)]-beta-D-Manp host organism:Oryctolagus cuniculus antibody name:anti-...

    Publication: 21237664;

  67. Synthesis of cross-reactive carbohydrate determinants fragments as tools for in vitro allergy diagnosis.

    ID: 1845121

    Description: epitope description:beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc host organism:Oryctolagus cuniculus antibody name...

    Publication: 21237664;

  68. A therapeutic antibody targeting BACE1 inhibits amyloid-beta production in vivo.

    ID: 1845943

    Description: epitope description:S314, E316, K317, F318, P319, Q327, L328, V329, C330, W331, Q332, A333, T335, P337, I340, T375, D378, C380 antigen name:Beta-secre...

    Publication: 21613622;

  69. A therapeutic antibody targeting BACE1 inhibits amyloid-beta production in vivo.

    ID: 1845947

    Description: epitope description:S314, E316, K317, F318, P319, Q327, L328, V329, C330, W331, Q332, A333, T335, P337, I340, T375, D378, C380 antigen name:Beta-secre...

    Publication: 21613622;

  70. Discrimination between the anti-monomeric and the anti-multimeric Lewis X response in murine schistosomiasis.

    ID: 1845948

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-D-Glcp antigen name:proteoglycan host organism:M...

    Publication: 15488731;

  71. Discrimination between the anti-monomeric and the anti-multimeric Lewis X response in murine schistosomiasis.

    ID: 1845958

    Description: epitope description:beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta...

    Publication: 15488731;

  72. Fine epitope mapping of monoclonal antibodies against hemagglutinin of a highly pathogenic H5N1 influenza virus using yeast surface display.

    ID: 1845965

    Description: epitope description:R224 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:H5-2A

    Publication: 21569761;

  73. Fine epitope mapping of monoclonal antibodies against hemagglutinin of a highly pathogenic H5N1 influenza virus using yeast surface display.

    ID: 1845968

    Description: epitope description:K250 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:H5-2A

    Publication: 21569761;

  74. Fine epitope mapping of monoclonal antibodies against hemagglutinin of a highly pathogenic H5N1 influenza virus using yeast surface display.

    ID: 1845975

    Description: epitope description:R178 antigen name:Hemagglutinin host organism:Mus musculus antibody name:NR2728

    Publication: 21569761;

  75. Bw4-reactive and Bw6-reactive antibodies recognize multiple distinct HLA structures that partially overlap in the alpha-1 helix.

    ID: 1845979

    Description: epitope description:L106, R107 antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus C57BL/6 HLA-B*1302 Tg ...

    Publication: 7523516;

  76. Structure of a core fragment of glycoprotein H from pseudorabies virus in complex with antibody.

    ID: 1845995

    Description: epitope description:V332, A333, P334, A335, Q337, P350, R351, D353, L354, R356, A357, T358, E361, A362, R365, K370, P371, F372, D373 antigen name:enve...

    Publication: 21149698;

  77. Structures of HIV-1 gp120 envelope glycoproteins from laboratory-adapted and primary isolates.

    ID: 1846595

    Description: epitope description:C118, V119, L121, V196, T198, Q199, R406, K408, Q409, I410, M421, P424 antigen name:Envelope glycoprotein gp160 host organism:Homo...

    Publication: 11188697;

  78. Structure of a nanobody-stabilized active state of the beta(2) adrenoceptor.

    ID: 1846597

    Description: epitope description:T68, I127, R131, I135, T136, P138, F139, V222, A226, K267, E268, A271, T274, L275, I278, I325, Y326, R328, P330 antigen name:Beta-...

    Publication: 21228869;

  79. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846609

    Description: epitope description:AAIHSVVHSI antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  80. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846614

    Description: epitope description:AQGSVQPQQL antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  81. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846617

    Description: epitope description:ARELNPSNKE antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  82. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846623

    Description: epitope description:CCQQLAQIPQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  83. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846626

    Description: epitope description:CNVYVPPECS antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  84. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846628

    Description: epitope description:CQAIHNVAHA antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  85. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846631

    Description: epitope description:CQQLLQIPEQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  86. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846633

    Description: epitope description:CSIMRAPFAS antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  87. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846637

    Description: epitope description:DIFLPLSQHE antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  88. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846653

    Description: epitope description:FAQPQQLFPE antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  89. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846656

    Description: epitope description:FIQPSLQQQL antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  90. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846661

    Description: epitope description:FPLQPQQPFP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  91. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846662

    Description: epitope description:FPLQPQQPFP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  92. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846663

    Description: epitope description:FPLQPQQPFP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  93. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846666

    Description: epitope description:FPPQQPYPQP antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 15876313;

  94. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846667

    Description: epitope description:FPPQQPYPQP antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 15876313;

  95. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846671

    Description: epitope description:FPQLQQPQQP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  96. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846680

    Description: epitope description:FPQQPQQPFP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  97. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846686

    Description: epitope description:FPQQPQQPFP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  98. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846697

    Description: epitope description:FPQQPYPQQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  99. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846698

    Description: epitope description:FPQQQFPQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  100. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846700

    Description: epitope description:FPQQSEQIIP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston