Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499972

    Description: epitope description:WGNGCGLFGKGSIDTCAKFA antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  2. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499975

    Description: epitope description:LTSGHLKCRVKMEKLQLKGT antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  3. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499976

    Description: epitope description:LTSGHLKCRVKMEKLQLKGT antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  4. Antibodies targeting linear determinants of the envelope protein protect mice against West Nile virus.

    ID: 1499979

    Description: epitope description:VLIELEPPFGDSYIVVGRGE antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 18190253;

  5. An immune response directed to proteinase and adhesin functional epitopes protects against Porphyromonas gingivalis-induced periodontal bone loss.

    ID: 1499992

    Description: epitope description:AHGSETAWAD antigen name:Other Porphyromonas gingivalis protein host organism:Mus musculus BALB/c

    Publication: 16148146;

  6. Antigenic sites of poliovirus type 3 eliciting IgA monoclonal antibodies in orally immunized mice.

    ID: 1499995

    Description: epitope description:D417 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1B8

    Publication: 11277698;

  7. Antigenic sites of poliovirus type 3 eliciting IgA monoclonal antibodies in orally immunized mice.

    ID: 1499998

    Description: epitope description:L576, R864, N866 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1F5, 1F9, 1G1, 2B5, 3B9

    Publication: 11277698;

  8. Inhibition of Porphyromonas gingivalis hemagglutinating activity by synthetic peptides derived from phage display selection using MAb against the reco...

    ID: 1500021

    Description: epitope description:MMELGRV host organism:Mus musculus BALB/c antibody name:Pg-ompA1

    Publication: 15684661;

  9. Inhibition of Porphyromonas gingivalis hemagglutinating activity by synthetic peptides derived from phage display selection using MAb against the reco...

    ID: 1500023

    Description: epitope description:VNPTYGN host organism:Mus musculus BALB/c antibody name:Pg-ompA1

    Publication: 15684661;

  10. Mimotope mapping as a complementary strategy to define allergen IgE-epitopes: peach Pru p 3 allergen as a model.

    ID: 1500030

    Description: epitope description:WPGSNLTPRTQT host organism:Homo sapiens

    Publication: 18242709;

  11. Mimotope mapping as a complementary strategy to define allergen IgE-epitopes: peach Pru p 3 allergen as a model.

    ID: 1500043

    Description: epitope description:KSNDLGSAPLQH host organism:Homo sapiens

    Publication: 18242709;

  12. Mimotope mapping as a complementary strategy to define allergen IgE-epitopes: peach Pru p 3 allergen as a model.

    ID: 1500046

    Description: epitope description:HNTVPSLWYHNR host organism:Homo sapiens

    Publication: 18242709;

  13. Schistosoma mansoni 28-kDa glutathione S-transferase and immunity against parasite fecundity and egg viability. Role of the amino- and carboxyl-termin...

    ID: 1500065

    Description: epitope description:YFDGRGRAESIRMTLVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Rattus norvegicus ...

    Publication: 8423348;

  14. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500073

    Description: epitope description:PPAAGPPAAGPPAAGPPAAG antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:EBV-positive serum

    Publication: 7595412;

  15. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500075

    Description: epitope description:PPAAGPRILAPLSAGPPAAG antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:EBV-positive serum

    Publication: 7595412;

  16. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500077

    Description: epitope description:PHIVTPPSARPRIMAPPVVR antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:EBV-positive serum

    Publication: 7595412;

  17. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500084

    Description: epitope description:PPAAGPPAAGPPAAGPPAAG antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:healthy human serum

    Publication: 7595412;

  18. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500086

    Description: epitope description:PPAAGPRILAPLSAGPPAAG antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:healthy human serum

    Publication: 7595412;

  19. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500087

    Description: epitope description:PLSAGPPAAGPHIVTPPSAR antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens antibody name:healthy human serum

    Publication: 7595412;

  20. An influenza A vaccine based on tetrameric ectodomain of matrix protein 2.

    ID: 1500094

    Description: epitope description:SLLTEVETPIRNEWGCRCNDSS antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 18252707;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston