Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1852983

    Description: epitope description:VFGQNAQFHYLYRSG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  2. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1852984

    Description: epitope description:VFGQNAQFHYLYRSG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21501643;

  3. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1852987

    Description: epitope description:LYRSGFCIHVQCNAS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  4. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1852990

    Description: epitope description:FCIHVQCNASKFHQG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21501643;

  5. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1852994

    Description: epitope description:KFHQGALLVAVLPEY antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21501643;

  6. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853001

    Description: epitope description:AGGTGTEDSHPPYKQ antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  7. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853006

    Description: epitope description:PPYKQTQPGADGFEL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21501643;

  8. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853021

    Description: epitope description:LPFDSALNHCNFGLL antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  9. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853025

    Description: epitope description:NFGLLVVPINPLDYD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  10. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853028

    Description: epitope description:VVPINPLDYDQGATP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21501643;

  11. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853031

    Description: epitope description:QGATPVIPITITLAP antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  12. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853037

    Description: epitope description:MCSEFAGLRQAVTQ antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  13. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853045

    Description: epitope description:TDDGVSAPILPNFHP antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  14. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853048

    Description: epitope description:SAPILPNFHPTPCIH antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21501643;

  15. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853065

    Description: epitope description:MERLRFPVSAQAGKG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  16. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853067

    Description: epitope description:FPVSAQAGKGELCAV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  17. A potent and highly specific FN3 monobody inhibitor of the Abl SH2 domain.

    ID: 1849720

    Description: epitope description:R134, R152, S154, S156, S162, R170, Y172, H173, Y174, R175, V205, D207, G208, L209, I210 antigen name:Tyrosine-protein kinase ABL1...

    Publication: 20357770;

  18. Biochemical and structural characterization of lysophosphatidic Acid binding by a humanized monoclonal antibody.

    ID: 1849728

    Description: epitope description:1-myristoyl-sn-glycerol 3-phosphate host organism:Mus musculus antibody name:LT3015

    Publication: 21392506;

  19. Biochemical and structural characterization of lysophosphatidic Acid binding by a humanized monoclonal antibody.

    ID: 1849736

    Description: epitope description:1-(18-mercaptooctadecanoyl)-sn-glycerol 3-phosphate host organism:Mus musculus antibody name:LT3015

    Publication: 21392506;

  20. Immunity to schistosomiasis: glycans are potential antigenic targets for immune intervention.

    ID: 1849742

    Description: epitope description:beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp antigen name:N-glycoprotein host organism:Homo sapiens

    Publication: 12932753;

  21. Immunity to schistosomiasis: glycans are potential antigenic targets for immune intervention.

    ID: 1849752

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc antigen name:N-glycoprotein host organism:Homo sapiens

    Publication: 12932753;

  22. Immunity to schistosomiasis: glycans are potential antigenic targets for immune intervention.

    ID: 1849756

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc antigen name:N-glycoprotein host organism:Mus musculus antibody name:CD15

    Publication: 12932753;

  23. Reduction of antibody response against botulinum neurotoxin A by synthetic monomethoxypolyethylene glycol-peptide conjugates.

    ID: 1849843

    Description: epitope description:KYTMFHYLRAQEFEHGKSR antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus ICR

    Publication: 21324340;

  24. Reduction of antibody response against botulinum neurotoxin A by synthetic monomethoxypolyethylene glycol-peptide conjugates.

    ID: 1849850

    Description: epitope description:SRTLGCSWEFIPVDDGWGERPL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus ICR

    Publication: 21324340;

  25. Structural insights into parallel strategies for germline antibody recognition of lipopolysaccharide from Chlamydia.

    ID: 1849859

    Description: epitope description:alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P antigen name:lipopolysaccharide hos...

    Publication: 21543444;

  26. Structural insights into parallel strategies for germline antibody recognition of lipopolysaccharide from Chlamydia.

    ID: 1849860

    Description: epitope description:alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P antigen name:lipopolysaccharide hos...

    Publication: 21543444;

  27. Structural insights into parallel strategies for germline antibody recognition of lipopolysaccharide from Chlamydia.

    ID: 1849861

    Description: epitope description:alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P antigen name:lipopolysaccharide hos...

    Publication: 21543444;

  28. Structural insights into parallel strategies for germline antibody recognition of lipopolysaccharide from Chlamydia.

    ID: 1849862

    Description: epitope description:alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P antigen name:lipopolysaccharide hos...

    Publication: 21543444;

  29. Structural insights into parallel strategies for germline antibody recognition of lipopolysaccharide from Chlamydia.

    ID: 1849863

    Description: epitope description:alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P antigen name:lipopolysaccharide hos...

    Publication: 21543444;

  30. Structural insights into parallel strategies for germline antibody recognition of lipopolysaccharide from Chlamydia.

    ID: 1849870

    Description: epitope description:alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcN-4P-(1->6)-alpha-D-GlcN-1P antigen name:lipopolysaccharide hos...

    Publication: 21543444;

  31. The selection and characterization of antibodies to minichromosome maintenance proteins that highlight cervical dysplasia.

    ID: 1849901

    Description: epitope description:PAELMRRFELYF antigen name:DNA replication licensing factor MCM7 host organism:Mus musculus antibody name:2E6.7

    Publication: 21601573;

  32. Function-blocking antithrombospondin-1 monoclonal antibodies.

    ID: 1849911

    Description: epitope description:DTDLDGWPNENLVCVANATYHCKKDN antigen name:Thrombospondin-1 host organism:Mus musculus antibody name:6.1

    Publication: 16420580;

  33. Structural insights into parallel strategies for germline antibody recognition of lipopolysaccharide from Chlamydia.

    ID: 1849917

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S64-4

    Publication: 21543444;

  34. Structural insights into parallel strategies for germline antibody recognition of lipopolysaccharide from Chlamydia.

    ID: 1849925

    Description: epitope description:alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc antigen name:lipopolysaccharide host organism:Mus musculus ...

    Publication: 21543444;

  35. beta-D-Glucose 1-phosphate. A structural unit and an immunological determinant of a glycan from streptococcal cell walls.

    ID: 1849936

    Description: epitope description:beta-D-glucose 1-phosphate antigen name:polysaccharide host organism:Oryctolagus cuniculus

    Publication: 6172422;

  36. Function-blocking antithrombospondin-1 monoclonal antibodies.

    ID: 1849945

    Description: epitope description:DTDLDGWPSENLVCVANATYHCKKDN antigen name:Thrombospondin-1 host organism:Mus musculus antibody name:6.1

    Publication: 16420580;

  37. Enhanced immunogenicity of a functional enzyme by T cell epitope modification.

    ID: 1849958

    Description: epitope description:LGADGSGQYSWIING antigen name:UniProt:G0IFT0 host organism:Cavia porcellus Hartley

    Publication: 11869454;

  38. Enhanced immunogenicity of a functional enzyme by T cell epitope modification.

    ID: 1849961

    Description: epitope description:KAVASGVVVVAAAGN antigen name:UniProt:G0IFT0 host organism:Cavia porcellus Hartley

    Publication: 11869454;

  39. Enhanced immunogenicity of a functional enzyme by T cell epitope modification.

    ID: 1849962

    Description: epitope description:EGTSGSSSTVGYPGK antigen name:UniProt:G0IFT0 host organism:Cavia porcellus Hartley

    Publication: 11869454;

  40. Enhanced immunogenicity of a functional enzyme by T cell epitope modification.

    ID: 1849963

    Description: epitope description:YPSVIAVGAVDSSNQ antigen name:UniProt:G0IFT0 host organism:Cavia porcellus Hartley

    Publication: 11869454;

  41. Synthesis and antibody-binding studies of a series of parasite fuco-oligosaccharides.

    ID: 1850098

    Description: epitope description:alpha-L-fucosyl-(1->3)-N-acetyl-beta-D-glucosamine antigen name:glycoprotein host organism:Mus musculus antibody name:128-1E7-C, 2...

    Publication: 15848768;

  42. Synthesis and antibody-binding studies of a series of parasite fuco-oligosaccharides.

    ID: 1850100

    Description: epitope description:alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)-beta-D-GlcpNAc antigen name:glycoprotein host organism:Mus musculus antibody name:257-4D8,...

    Publication: 15848768;

  43. Structural definition of a conserved neutralization epitope on HIV-1 gp120.

    ID: 1850154

    Description: epitope description:C119, V120, L122, V200, T202, Q203, A204, C205, R419, K421, Q422, I423, M434, P437 antigen name:Envelope glycoprotein gp160 host o...

    Publication: 17301785;

  44. Trypanosoma cruzi subverts host cell sialylation and may compromise antigen-specific CD8+ T cell responses.

    ID: 1850187

    Description: epitope description:sialic acid antigen name:Leukosialin host organism:Rattus norvegicus antibody name:S7

    Publication: 20106975;

  45. Antigenically relevant amino acid positions as revealed by reactions of monoclonal antibodies with the nucleoproteins of closely related influenza A v...

    ID: 1850196

    Description: epitope description:V353 antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mab 7/3

    Publication: 15503212;

  46. Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.

    ID: 1850204

    Description: epitope description:17beta-estradiol 6-O-(carboxymethyl)oxime host organism:Mus musculus antibody name:10G6

    Publication: 11812141;

  47. Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.

    ID: 1850208

    Description: epitope description:17beta-estradiol 6-O-(carboxymethyl)oxime host organism:Mus musculus antibody name:10G6

    Publication: 11812141;

  48. Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.

    ID: 1850215

    Description: epitope description:17beta-estradiol host organism:Mus musculus antibody name:17E12

    Publication: 11812141;

  49. Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.

    ID: 1850231

    Description: epitope description:6,7-didehydro-17beta-estradiol host organism:Mus musculus antibody name:10G6

    Publication: 11812141;

  50. Mapping of B-cell epitopes in a Trypanosoma cruzi immunodominant antigen expressed in natural infections.

    ID: 1850695

    Description: epitope description:SPPVSAPAKAAAPPAAARSAEPHVG antigen name:Immunodominant antigen, putative,tc40 antigen-like, putative host organism:Homo sapiens

    Publication: 15699429;

  51. An exposed domain in the severe acute respiratory syndrome coronavirus spike protein induces neutralizing antibodies.

    ID: 1850697

    Description: epitope description:STAIHADQLTPAWRIYSTGNN antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:S78, S26

    Publication: 15194798;

  52. An exposed domain in the severe acute respiratory syndrome coronavirus spike protein induces neutralizing antibodies.

    ID: 1850701

    Description: epitope description:FQQFGRDVSDFTDSVRDPKT antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:S34, S84

    Publication: 15194798;

  53. Identification of an antigenic determinant on the S2 domain of the severe acute respiratory syndrome coronavirus spike glycoprotein capable of inducin...

    ID: 1850707

    Description: epitope description:TATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKA antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15194770;

  54. Synthesis of the carbohydrate moiety from the parasite Echinococcus multilocularis and their antigenicity against human sera.

    ID: 1850714

    Description: epitope description:alpha-D-Galp-(1->4)-beta-D-Galp-(1->3)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc antigen name:O-glycoprotein host organism:Homo sapi...

    Publication: 21402433;

  55. Identification of an antigenic determinant on the S2 domain of the severe acute respiratory syndrome coronavirus spike glycoprotein capable of inducin...

    ID: 1850726

    Description: epitope description:RSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLP antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15194770;

  56. Identification of an antigenic determinant on the S2 domain of the severe acute respiratory syndrome coronavirus spike glycoprotein capable of inducin...

    ID: 1850727

    Description: epitope description:RSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLP antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15194770;

  57. Identification of conformational neutralizing epitopes on the capsid protein of canine calicivirus.

    ID: 1850732

    Description: epitope description:G517 antigen name:capsid protein precursor host organism:Mus musculus BALB/c antibody name:27G2

    Publication: 11413381;

  58. Identification of protective epitopes on ebola virus glycoprotein at the single amino acid level by using recombinant vesicular stomatitis viruses.

    ID: 1850861

    Description: epitope description:H549 antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c antibody name:133/3.16

    Publication: 12502822;

  59. Immunological studies on tartrazine and its metabolites. I. Animal studies.

    ID: 1850903

    Description: epitope description:tartrazine host organism:Rattus norvegicus Wistar

    Publication: 2409032;

  60. Immunological studies on tartrazine and its metabolites. I. Animal studies.

    ID: 1850949

    Description: epitope description:4-aminobenzenesulfonic acid host organism:Rattus norvegicus Wistar

    Publication: 2409032;

  61. Immunological studies on tartrazine and its metabolites. I. Animal studies.

    ID: 1850951

    Description: epitope description:4-aminobenzenesulfonic acid host organism:Rattus norvegicus Wistar

    Publication: 2409032;

  62. Immunological studies on tartrazine and its metabolites. I. Animal studies.

    ID: 1850955

    Description: epitope description:1-(4-sulfophenyl)-3-carboxy-4-amino-5-oxopyrazole host organism:Cavia porcellus Duncan-Hartley

    Publication: 2409032;

  63. Immunological studies on tartrazine and its metabolites. I. Animal studies.

    ID: 1850960

    Description: epitope description:1-(4-sulfophenyl)-3-carboxy-4-amino-5-oxopyrazole host organism:Rattus norvegicus Wistar

    Publication: 2409032;

  64. Identification of protective epitopes on ebola virus glycoprotein at the single amino acid level by using recombinant vesicular stomatitis viruses.

    ID: 1850975

    Description: epitope description:R134, F194, L199 antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c antibody name:226/8.1

    Publication: 12502822;

  65. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1850979

    Description: epitope description:VRVPVPQLQL antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  66. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1850980

    Description: epitope description:VPVPQLQLQN antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  67. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1850993

    Description: epitope description:YPQPQPFPSQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  68. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851012

    Description: epitope description:PQQPYPQPQP antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 21366336;

  69. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851014

    Description: epitope description:YPQPQPQYSQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  70. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851022

    Description: epitope description:QQQQQILQQI antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 21366336;

  71. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851024

    Description: epitope description:LQQQLIPCRD antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 21366336;

  72. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851026

    Description: epitope description:VVLQQHNIAH antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  73. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851035

    Description: epitope description:QQHHHHQEQK antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 21366336;

  74. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851048

    Description: epitope description:QQQQQPLSQV antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  75. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851052

    Description: epitope description:QVSFQQPQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  76. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851054

    Description: epitope description:QQPQQQYPSG antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 21366336;

  77. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851056

    Description: epitope description:QQYPSGQGFF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  78. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846871

    Description: epitope description:PLQPQQPFPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  79. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846873

    Description: epitope description:PLSQHEQVGQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  80. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846875

    Description: epitope description:PLVQQQQFPG antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  81. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846880

    Description: epitope description:PQFAEIRNLA antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  82. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846881

    Description: epitope description:PQFAEIRNLA antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  83. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846884

    Description: epitope description:PQLPYPQPQS antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  84. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846893

    Description: epitope description:PQPQQPQQPF antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  85. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846901

    Description: epitope description:PQQPFPLQPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  86. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846903

    Description: epitope description:PQQPFPQLQQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  87. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846907

    Description: epitope description:PQQPFPQPQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  88. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846915

    Description: epitope description:PQQPFPQQPQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  89. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846921

    Description: epitope description:PQQPFPQQPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  90. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846925

    Description: epitope description:PQQPFPQTQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  91. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846929

    Description: epitope description:PQQPFPQTQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  92. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846930

    Description: epitope description:PQQPFPWQPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  93. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846935

    Description: epitope description:PQQPQQPFLQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  94. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846938

    Description: epitope description:PQQPQQPFPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  95. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846941

    Description: epitope description:PQQPQQSFPQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  96. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846947

    Description: epitope description:PQQPYPQQQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  97. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846952

    Description: epitope description:PQQQRPFIQP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  98. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846962

    Description: epitope description:PQQTFPQPQQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  99. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846965

    Description: epitope description:PRPQQSPEQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  100. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846966

    Description: epitope description:PSQQQPQEQV antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 15876313;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston