Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Antigenicity of Leishmania braziliensis histone H1 during cutaneous leishmaniasis: localization of antigenic determinants.

    ID: 1371393

    Description: epitope description:KKAAAKKAAAKKAAPKKAAP antigen name:Histone H1 host organism:Homo sapiens

    Publication: 12093677;

  2. Antigenicity of Leishmania braziliensis histone H1 during cutaneous leishmaniasis: localization of antigenic determinants.

    ID: 1371396

    Description: epitope description:APKKAAAKRAAKKSAPKKAV antigen name:Histone H1 host organism:Homo sapiens

    Publication: 12093677;

  3. Antigenicity of Leishmania braziliensis histone H1 during cutaneous leishmaniasis: localization of antigenic determinants.

    ID: 1371398

    Description: epitope description:APKKAVKKAVKAAKKAVKKA antigen name:Putative histone H1 host organism:Homo sapiens

    Publication: 12093677;

  4. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371410

    Description: epitope description:TPHSGEEHAVGNDTGKHGKEIKITPQSSITE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2371772;

  5. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371412

    Description: epitope description:KHSMVDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  6. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371414

    Description: epitope description:CTGKFKIVKEIAETQHGTIVIRVQYEGDGSPC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  7. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1371423

    Description: epitope description:YISGYFVTDP antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:9C9

    Publication: 17301219;

  8. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1371424

    Description: epitope description:RFDKGYISGY antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:CRP-8

    Publication: 17301219;

  9. The dual-specific binding of dengue virus and target cells for the antibody-dependent enhancement of dengue virus infection.

    ID: 1371427

    Description: epitope description:CPFLKQNEPEDIDCW antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:anti-prM (70-21)

    Publication: 16493039;

  10. Induction of polyclonal and monoclonal antibody responses to cholera toxin by the synthetic peptide approach.

    ID: 1371431

    Description: epitope description:HIDSQKKAIERMK antigen name:Cholera enterotoxin subunit B host organism:Mus musculus BALB/c antibody name:CTBP1-F3<...

    Publication: 3374493;

  11. The dual-specific binding of dengue virus and target cells for the antibody-dependent enhancement of dengue virus infection.

    ID: 1371433

    Description: epitope description:CPFLKQNEPEDIDCW antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:anti-prM (70-21)

    Publication: 16493039;

  12. Induction of polyclonal and monoclonal antibody responses to cholera toxin by the synthetic peptide approach.

    ID: 1371434

    Description: epitope description:HIDSQKKAIERMK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus

    Publication: 3374493;

  13. Mapping of the antigenic determinants of the Leishmania infantum gp63 protein recognized by antibodies elicited during canine visceral leishmaniasis.

    ID: 1371935

    Description: epitope description:ASSAAEFLAAFNVFSEAARC antigen name:GP63, leishmanolysin host organism:Canis lupus familiaris

    Publication: 9172421;

  14. Mapping of the antigenic determinants of the Leishmania infantum gp63 protein recognized by antibodies elicited during canine visceral leishmaniasis.

    ID: 1371936

    Description: epitope description:EAARCIDGAFTPKNRTAADG antigen name:GP63, leishmanolysin host organism:Canis lupus familiaris

    Publication: 9172421;

  15. Mapping of the antigenic determinants of the Leishmania infantum gp63 protein recognized by antibodies elicited during canine visceral leishmaniasis.

    ID: 1371940

    Description: epitope description:TVSNAFEEGGCITCPPYVEV antigen name:GP63, leishmanolysin host organism:Canis lupus familiaris

    Publication: 9172421;

  16. Identification of naturally occurring monoclonal antibody escape variants of louping ill virus.

    ID: 1371946

    Description: epitope description:D308 antigen name:Genome polyprotein host organism:Mus musculus antibody name:4.2 and 7.1

    Publication: 8126456;

  17. The humoral immune response to the kinetoplastid membrane protein-11 in patients with American leishmaniasis and Chagas disease: prevalence of IgG sub...

    ID: 1371947

    Description: epitope description:GEEFNRKMQEQNAKFFADKP antigen name:Kinetoplastid membrane protein-11 host organism:Homo sapiens

    Publication: 10656675;

  18. The humoral immune response to the kinetoplastid membrane protein-11 in patients with American leishmaniasis and Chagas disease: prevalence of IgG sub...

    ID: 1371952

    Description: epitope description:EHYEKFERMIKEHTEKFNKK antigen name:Kinetoplastid membrane protein-11 host organism:Homo sapiens

    Publication: 10656675;

  19. The humoral immune response to the kinetoplastid membrane protein-11 in patients with American leishmaniasis and Chagas disease: prevalence of IgG sub...

    ID: 1371953

    Description: epitope description:EHYEKFERMIKEHTEKFNKK antigen name:Kinetoplastid membrane protein-11 host organism:Canis lupus familiaris

    Publication: 10656675;

  20. Antigenicity of the Leishmania infantum histones H2B and H4 during canine viscerocutaneous leishmaniasis.

    ID: 1371973

    Description: epitope description:ANKKRTLGAREVQTAVRIVL antigen name:Histone H2B host organism:Canis lupus familiaris antibody name:Dog Sera

    Publication: 9933463;

  21. Antigenicity of the Leishmania infantum histones H2B and H4 during canine viscerocutaneous leishmaniasis.

    ID: 1371984

    Description: epitope description:TACDVVTALRKQGHILYGYA antigen name:Histone H4 host organism:Canis lupus familiaris antibody name:Dog Sera

    Publication: 9933463;

  22. Mapping of the linear antigenic determinants from the Leishmania infantum histone H2A recognized by sera from dogs with leishmaniasis.

    ID: 1371989

    Description: epitope description:KGGKKGKATPSA antigen name:Histone H2A host organism:Canis lupus familiaris

    Publication: 8867853;

  23. Mapping of the linear antigenic determinants from the Leishmania infantum histone H2A recognized by sera from dogs with leishmaniasis.

    ID: 1371990

    Description: epitope description:ISKAMAKKKGGKKGKATPSA antigen name:Histone H2A host organism:Canis lupus familiaris

    Publication: 8867853;

  24. Mapping of the linear antigenic determinants from the Leishmania infantum histone H2A recognized by sera from dogs with leishmaniasis.

    ID: 1371995

    Description: epitope description:KRCRLNPRTVMLAARHDDDI antigen name:Histone H2A host organism:Canis lupus familiaris

    Publication: 8867853;

  25. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 1372049

    Description: epitope description:MTEQQWNFAGIEAAAS antigen name:6 kDa early secretory antigenic target host organism:Homo sapiens antibody name:Human sera

    Publication: 15325505;

  26. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 1372080

    Description: epitope description:DQVHFQPLPPAVVKLSDALI antigen name:Phosphate-binding protein PstS 1 host organism:Homo sapiens

    Publication: 15325505;

  27. Generation and characterization of monoclonal antibodies against dengue virus type 1 for epitope mapping and serological detection by epitope-based pe...

    ID: 1372120

    Description: epitope description:DPLTSLHAMQRR host organism:Homo sapiens

    Publication: 17287314;

  28. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372138

    Description: epitope description:MPSITTAKREYEERLVDCLT antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  29. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372141

    Description: epitope description:MANSSLLRVVLVALLLLGSV antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  30. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372148

    Description: epitope description:TSVLDAHRVKRAARVGAISP antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  31. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372150

    Description: epitope description:GMEPTQTSFFQALNIATKIA antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  32. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372152

    Description: epitope description:KVLSVGDKVDNSTATLLQKL antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  33. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372156

    Description: epitope description:LSNVAAMALGAGIPTSSTIG antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  34. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372162

    Description: epitope description:AAKEEPEESDEDDFGMGGLF antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  35. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372163

    Description: epitope description:PSAAAKEEPEESDEDD antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  36. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372165

    Description: epitope description:SCSAAAEPAAAAPAAPSAAAKEEPEESDEDDFGMGGLF antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  37. Characterizing cellular immune response to kinetoplastid membrane protein-11 (KMP-11) during Leishmania (Viannia) panamensis infection using dendritic...

    ID: 1372210

    Description: epitope description:DEEFNKKMQEQNAKFFADKP antigen name:kinetoplastid membrane protein-11 (GenPept:685207604) host organism:Homo sapiens

    Publication: 12940963;

  38. Characterizing cellular immune response to kinetoplastid membrane protein-11 (KMP-11) during Leishmania (Viannia) panamensis infection using dendritic...

    ID: 1372212

    Description: epitope description:FADKPDESTLSPEMKEHYDK antigen name:kinetoplastid membrane protein-11 (GenPept:685207605) host organism:Homo sapiens

    Publication: 12940963;

  39. Characterizing cellular immune response to kinetoplastid membrane protein-11 (KMP-11) during Leishmania (Viannia) panamensis infection using dendritic...

    ID: 1372214

    Description: epitope description:EHYDKFERMIKEHTEKFNKK antigen name:kinetoplastid membrane protein-11 (GenPept:685207605) host organism:Homo sapiens

    Publication: 12940963;

  40. Characterizing cellular immune response to kinetoplastid membrane protein-11 (KMP-11) during Leishmania (Viannia) panamensis infection using dendritic...

    ID: 1372216

    Description: epitope description:KFNKKMHEHSEHFKHKFAEL antigen name:kinetoplastid membrane protein-11 (GenPept:685207605) host organism:Homo sapiens

    Publication: 12940963;

  41. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372220

    Description: epitope description:TVSAGDGRGTPIAFQAEVSK antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  42. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372226

    Description: epitope description:GVGAGGGDQNNLIGQFGVGF antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  43. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372230

    Description: epitope description:FLSAETIKKTIHQYSEFINF antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  44. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372233

    Description: epitope description:TQGVVKERRWTLVNENRPIW antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  45. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372237

    Description: epitope description:VPNTNIKLYVRRVFITDEFR antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  46. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372240

    Description: epitope description:LVRKTLSMFADIAAQDEAIA antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  47. Mapping of the linear antigenic determinants of the Leishmania infantum hsp70 recognized by leishmaniasis sera.

    ID: 1372414

    Description: epitope description:PKVQSLVSDFFGGKELNKSI antigen name:Putative heat-shock protein hsp70 host organism:Canis lupus familiaris antibody name:canine sera

    Publication: 8905399;

  48. Mapping of the linear antigenic determinants of the Leishmania infantum hsp70 recognized by leishmaniasis sera.

    ID: 1372418

    Description: epitope description:LESVCNPIMTKMYQSMGGAA antigen name:Putative heat-shock protein hsp70 host organism:Canis lupus familiaris antibody name:canine sera

    Publication: 8905399;

  49. Mapping of the linear antigenic determinants of the Leishmania infantum hsp70 recognized by leishmaniasis sera.

    ID: 1372419

    Description: epitope description:IAYGLDKGDDGKERNVLIFD antigen name:Putative heat-shock protein hsp70 host organism:Canis lupus familiaris antibody name:canine sera

    Publication: 8905399;

  50. Molecular mimicry between the immunodominant ribosomal protein P0 of Trypanosoma cruzi and a functional epitope on the human beta 1-adrenergic recepto...

    ID: 1372453

    Description: epitope description:HWWRAESDEARRCYNDPKCCDFVTNR antigen name:Beta-1 adrenergic receptor host organism:Homo sapiens

    Publication: 7790824;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston