Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Analysis of the neutralization epitopes on human rotavirus VP7 recognized by monotype-specific monoclonal antibodies.

    ID: 1507839

    Description: epitope description:D97 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:K8-12G2

    Publication: 1714939;

  2. Immunogenicity of peptides coupled with multiple T-cell epitopes of a surface protein antigen of Streptococcus mutans.

    ID: 1507872

    Description: epitope description:TYEAALKQYEADLAA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.M

    Publication: 8690461;

  3. Immunogenicity of peptides coupled with multiple T-cell epitopes of a surface protein antigen of Streptococcus mutans.

    ID: 1507888

    Description: epitope description:TYEAALKQYEA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.M

    Publication: 8690461;

  4. Protective immune response to foot-and-mouth disease virus with VP1 expressed in transgenic plants.

    ID: 1507920

    Description: epitope description:RYSRNAVPNVRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 9445079;

  5. Protection of cattle and swine against foot-and-mouth disease, using biosynthetic peptide vaccines.

    ID: 1507959

    Description: epitope description:SASGSGVRGDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 2154148;

  6. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507968

    Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:3

    Publication: 1656083;

  7. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507971

    Description: epitope description:N147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1, RV-4:5

    Publication: 1656083;

  8. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507972

    Description: epitope description:N147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1, RV-4:5

    Publication: 1656083;

  9. Protection of cattle and swine against foot-and-mouth disease, using biosynthetic peptide vaccines.

    ID: 1507973

    Description: epitope description:SASGSGVRGDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Sus scrofa Yorkshire

    Publication: 2154148;

  10. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507985

    Description: epitope description:S147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1

    Publication: 1656083;

  11. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508075

    Description: epitope description:PPYVEPTAPQVL antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1537894;

  12. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508082

    Description: epitope description:GDYSPSCCTLTIGVSSYHSKPCNPAQPVCS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  13. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508083

    Description: epitope description:TKKPNRNGGGYYSASYSDPGSLKCPVY antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  14. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508088

    Description: epitope description:LVQLTLQSTNYTCIVCIDRASLST antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  15. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508090

    Description: epitope description:STWHVLYSPNVSVPSSSSTP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  16. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508102

    Description: epitope description:LDLLFWEQGGLCKALQEQCRFP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  17. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508105

    Description: epitope description:GWGLNWDLGLSQWAREALQTGIT antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  18. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508107

    Description: epitope description:LAGPCILRQLRHLPSRVRYPHYSLIKPESSL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  19. Two different 8 kDa monomers are involved in the oligomeric organization of the native Echinococcus granulosus antigen B.

    ID: 1508114

    Description: epitope description:LKMFGEVKYFFERDPLGQKVVDLLKEL antigen name:AntigenB host organism:Mus musculus antibody name:AB10, BG10, DC11, EB7, EG9 and CB5

    Publication: 9226697;

  20. Serological responses of patients with ectopic pregnancy to epitopes of the Chlamydia trachomatis 60 kDa heat shock protein.

    ID: 1508116

    Description: epitope description:SANNDAEIGNLI antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 9619577;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston