Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852019

    Description: epitope description:MGVFFGGLGIGTGSG antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  2. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852031

    Description: epitope description:PPTPAETGGHFTLSS antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  3. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852035

    Description: epitope description:TSSTPIPGSRPVARL antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  4. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852042

    Description: epitope description:PDFLDIVALHRPALT antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  5. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852053

    Description: epitope description:SGYIPANTTIPFGGA antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  6. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852059

    Description: epitope description:SYYMLRKRRKRLPYF antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  7. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852061

    Description: epitope description:MCLYTRVLILHYHLL antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  8. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852067

    Description: epitope description:QMALWRPSDNTVYLP antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  9. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852071

    Description: epitope description:SRLLTVGNPYFRVPA antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  10. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852078

    Description: epitope description:GQPLGVGLSGHPFYN antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  11. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852081

    Description: epitope description:SEDVRDNVSVDYKQT antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  12. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852096

    Description: epitope description:VYSPSPSGSIVTSDS antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  13. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852107

    Description: epitope description:LEDWNFGVPPPPTTS antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  14. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852112

    Description: epitope description:VDLKEKFSLDLDQYP antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  15. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852127

    Description: epitope description:VVIEPVGPTDPSIVT antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  16. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852129

    Description: epitope description:SVVTSGAPRPTFTGT antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  17. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852139

    Description: epitope description:SSTPLPTVRRVAGPR antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  18. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852141

    Description: epitope description:YQQVSVANPEFLTRP antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  19. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852143

    Description: epitope description:YDNPAFEPVDTTLTF antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  20. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852144

    Description: epitope description:TTLTFDPRSDVPDSD antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  21. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852145

    Description: epitope description:VPDSDFMDIIRLHRP antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  22. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852150

    Description: epitope description:HDISPIAPSPEYIEL antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  23. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852152

    Description: epitope description:ATEDNDLFDIYADDM antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  24. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852153

    Description: epitope description:YADDMDPAVPVPSRS antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  25. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852156

    Description: epitope description:ASSYSNVTVPLTSSW antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  26. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852157

    Description: epitope description:LTSSWDVPVYTGPDI antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  27. Rational chemical design of the carbohydrate in a glycoconjugate vaccine enhances IgM-to-IgG switching.

    ID: 1852164

    Description: epitope description:{4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Glcp-(1->4)-[beta-D-Glcp-(1->3)]-beta-D-Galp-(1->4)-bet...

    Publication: 18378894;

  28. Rational chemical design of the carbohydrate in a glycoconjugate vaccine enhances IgM-to-IgG switching.

    ID: 1852170

    Description: epitope description:{4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Glcp-(1->4)-[beta-D-Glcp-(1->3)]-beta-D-Galp-(1->4)-bet...

    Publication: 18378894;

  29. Rational chemical design of the carbohydrate in a glycoconjugate vaccine enhances IgM-to-IgG switching.

    ID: 1852175

    Description: epitope description:{4)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Glcp-(1->4)-[beta-D-Glcp-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-(1->}n antig...

    Publication: 18378894;

  30. Rational chemical design of the carbohydrate in a glycoconjugate vaccine enhances IgM-to-IgG switching.

    ID: 1852182

    Description: epitope description:{4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Glcp-(1->4)-[beta-D-Glcp-(1->3)]-beta-D-Galp-(1->4)-bet...

    Publication: 18378894;

  31. beta-D-Glucose 1-phosphate. A structural unit and an immunological determinant of a glycan from streptococcal cell walls.

    ID: 1852185

    Description: epitope description:methyl beta-D-glucopyranoside host organism:Oryctolagus cuniculus

    Publication: 6172422;

  32. Ion permeation through a Cl--selective channel designed from a CLC Cl-/H+ exchanger.

    ID: 1852186

    Description: epitope description:A: K243, D246, P248, L249, N250, P380, Q381, Y382, H383; B: I231, H234, E235 antigen name:H(+)/Cl(-) exchange transporter ClcA hos...

    Publication: 18678918;

  33. Rational chemical design of the carbohydrate in a glycoconjugate vaccine enhances IgM-to-IgG switching.

    ID: 1852187

    Description: epitope description:{4)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Glcp-(1->4)-[beta-D-Glcp-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-(1->}n antig...

    Publication: 18378894;

  34. Rational chemical design of the carbohydrate in a glycoconjugate vaccine enhances IgM-to-IgG switching.

    ID: 1852193

    Description: epitope description:{4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Glcp-(1->4)-beta-D-Galp-(1->4)-beta-D-Glcp-(1->}n antig...

    Publication: 18378894;

  35. Enhanced immunogenicity of a functional enzyme by T cell epitope modification.

    ID: 1852230

    Description: epitope description:GNKYGAYNGTSMASP antigen name:UniProt:G0IFT0 host organism:Cavia porcellus Hartley

    Publication: 11869454;

  36. Enhanced immunogenicity of a functional enzyme by T cell epitope modification.

    ID: 1852235

    Description: epitope description:HVAGAAALILSKHPN antigen name:UniProt:G0IFT0 host organism:Cavia porcellus Hartley

    Publication: 11869454;

  37. Enhanced immunogenicity of a functional enzyme by T cell epitope modification.

    ID: 1852238

    Description: epitope description:NNSIGVLGVAPSASL antigen name:UniProt:G0IFT0 host organism:Cavia porcellus Hartley

    Publication: 11869454;

  38. Design of the blood group AB glycotope.

    ID: 1852309

    Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-D-Galp host organism:Mus musculus antibody name:2-32

    Publication: 16133833;

  39. Design of the blood group AB glycotope.

    ID: 1852313

    Description: epitope description:alpha-D-GalpN-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp host organism:Mus musculus antibody name:2-32

    Publication: 16133833;

  40. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1852318

    Description: epitope description:EAPTTDFYLKNNKGDA antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8277272;

  41. Synthesis and antigenic properties of C-7-modified Kdo mono- and disaccharide ligands and Kdo disaccharide interresidue lactones.

    ID: 1852329

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S67-27

    Publication: 19665108;

  42. Glycotope analysis in miracidia and primary sporocysts of Schistosoma mansoni: differential expression during the miracidium-to-sporocyst transformati...

    ID: 1852348

    Description: epitope description:beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc antigen name:glycoprotein host organism:Mus musculu...

    Publication: 19545571;

  43. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851260

    Description: epitope description:TIAPFGIFGT antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus alpha1KI antibody ...

    Publication: 21366336;

  44. Drug antigenicity, immunogenicity, and costimulatory signaling: evidence for formation of a functional antigen through immune cell metabolism.

    ID: 1851273

    Description: epitope description:sulfamethoxazole host organism:Oryctolagus cuniculus

    Publication: 20980635;

  45. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851277

    Description: epitope description:MGQNLSTSNPLGFFPDHQLDP antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  46. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851284

    Description: epitope description:GQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPN antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  47. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851299

    Description: epitope description:GQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVG antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  48. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851306

    Description: epitope description:NPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVG antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  49. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851326

    Description: epitope description:PANPPPASTNRQSGRQPTPLSPPLRNTHPQA antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  50. Analysis of Helicobacter pylori isolates from Chile: occurrence of selective type 1 Lewis b antigen expression in lipopolysaccharide.

    ID: 1851332

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc antigen name:lipopolysaccharide host organism:Mus musc...

    Publication: 18436591;

  51. Analysis of Helicobacter pylori isolates from Chile: occurrence of selective type 1 Lewis b antigen expression in lipopolysaccharide.

    ID: 1851333

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc antigen name:lipopolysaccharide host organism:Mus musc...

    Publication: 18436591;

  52. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851342

    Description: epitope description:PTPLSPPLRNTHPQA antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  53. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851343

    Description: epitope description:PTPLSPPLRNTHPQA antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  54. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851360

    Description: epitope description:PLRNTHPQAMQWNSTTF antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  55. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851361

    Description: epitope description:PLRNTHPQAMQWNSTTF antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  56. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851486

    Description: epitope description:TSNPLGFFPDHQLDP antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  57. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851493

    Description: epitope description:FFPDHQLDPAFRANT antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  58. N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

    ID: 1851506

    Description: epitope description:DHQLDPAFRANTANP antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 21145866;

  59. Combined CD4 T-cell and antibody response to human minor histocompatibility antigen DBY after allogeneic stem-cell transplantation.

    ID: 1851529

    Description: epitope description:EASKGFHDKDSSGWSCSK antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

    Publication: 21709606;

  60. Combined CD4 T-cell and antibody response to human minor histocompatibility antigen DBY after allogeneic stem-cell transplantation.

    ID: 1851530

    Description: epitope description:DKDSSGWSCSKDKDAYSSF antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

    Publication: 21709606;

  61. Identification of immunogenic regions within the alternative reading frame protein of hepatitis C virus (genotype 3).

    ID: 1851685

    Description: epitope description:TKRNTIRRPQNVKFPGGGQI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 21318731;

  62. Identification of immunogenic regions within the alternative reading frame protein of hepatitis C virus (genotype 3).

    ID: 1851701

    Description: epitope description:SSIPLRADSPTSWGTSRSSV antigen name:F protein host organism:Homo sapiens

    Publication: 21318731;

  63. Identification of immunogenic regions within the alternative reading frame protein of hepatitis C virus (genotype 3).

    ID: 1851702

    Description: epitope description:TSWGTSRSSVLPQGASQEPS antigen name:F protein host organism:Homo sapiens

    Publication: 21318731;

  64. A common NH53K mutation in the combining site of antibodies raised against chlamydial LPS glycoconjugates significantly increases avidity.

    ID: 1851745

    Description: epitope description:alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:...

    Publication: 21405106;

  65. A common NH53K mutation in the combining site of antibodies raised against chlamydial LPS glycoconjugates significantly increases avidity.

    ID: 1851752

    Description: epitope description:alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->6)-beta-D-GlcNAc antigen name:lipopolysaccharide host organism:Mus musculus ...

    Publication: 21405106;

  66. Mapping the binding of synthetic disaccharides representing epitopes of chlamydial lipopolysaccharide to antibodies with NMR.

    ID: 1851756

    Description: epitope description:alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-39, S25-2

    Publication: 11041842;

  67. Mapping the binding of synthetic disaccharides representing epitopes of chlamydial lipopolysaccharide to antibodies with NMR.

    ID: 1851757

    Description: epitope description:alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S23-24

    Publication: 11041842;

  68. Mapping the binding of synthetic disaccharides representing epitopes of chlamydial lipopolysaccharide to antibodies with NMR.

    ID: 1851760

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S23-24

    Publication: 11041842;

  69. Mapping the binding of synthetic disaccharides representing epitopes of chlamydial lipopolysaccharide to antibodies with NMR.

    ID: 1851763

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S23-24

    Publication: 11041842;

  70. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851771

    Description: epitope description:SIFYHAETERLLTIG antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  71. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851772

    Description: epitope description:LLTIGHPYYPVSIGA antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  72. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851774

    Description: epitope description:VSANQYRVFKIQLPD antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  73. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851786

    Description: epitope description:CPPLELKNKHIEDGD antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  74. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851792

    Description: epitope description:SMFFFARKEQVYVRH antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  75. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851798

    Description: epitope description:NQIFNRPYWLFRAQG antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  76. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851799

    Description: epitope description:FRAQGMNNGIAWNNL antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  77. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851802

    Description: epitope description:ISVASDGTPLTEYDS antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  78. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851806

    Description: epitope description:ITAQTVSHLQGLMPS antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  79. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851807

    Description: epitope description:GLMPSVLENWEIGVQ antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  80. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851810

    Description: epitope description:SPATKCASNVIPAKE antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  81. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851811

    Description: epitope description:IPAKEDPYAGFKFWN antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  82. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851819

    Description: epitope description:QAGTCPPDVIPKVEG antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  83. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851821

    Description: epitope description:KILKFGGLAIYLGGL antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  84. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851829

    Description: epitope description:YEDTVLPEAPAIVTP antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  85. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851832

    Description: epitope description:TDSSTETLITLLEPE antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  86. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851838

    Description: epitope description:LENIFVGGSGLGDTG antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  87. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851840

    Description: epitope description:LTYFGSPRTSTPRSI antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  88. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851841

    Description: epitope description:TPRSIASKSRGILNW antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  89. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851846

    Description: epitope description:GPSGRVGLSQVYKPD antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  90. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851858

    Description: epitope description:DTYSASPVTDPDSTS antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  91. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851861

    Description: epitope description:IDGHTVDLYSSNYTL antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  92. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851864

    Description: epitope description:MALWQQGQKLYLPPT antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  93. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851871

    Description: epitope description:IQLPDPNQFALPDRT antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  94. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851886

    Description: epitope description:QNEICLYPDYLKMAE antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  95. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851889

    Description: epitope description:VYVRHIWTRGGSEKE antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  96. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851899

    Description: epitope description:SEYDTGKFNLYHRHM antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  97. Mapping of linear B cell epitopes on capsid proteins of bovine papillomavirus: identification of three external type-restricted epitopes.

    ID: 1851903

    Description: epitope description:GLMPSVLQNWEIGVQ antigen name:Major capsid protein L1 host organism:Oryctolagus cuniculus

    Publication: 8277272;

  98. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1847313

    Description: epitope description:QTFPQPQQTF antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  99. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1847317

    Description: epitope description:QTQQPQQPFP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  100. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1847318

    Description: epitope description:QTQQPQQPFP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston