Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Serological responses of patients with ectopic pregnancy to epitopes of the Chlamydia trachomatis 60 kDa heat shock protein.

    ID: 1508119

    Description: epitope description:ATLVVNRIRGGF antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 9619577;

  2. Serological responses of patients with ectopic pregnancy to epitopes of the Chlamydia trachomatis 60 kDa heat shock protein.

    ID: 1508121

    Description: epitope description:ILPGGGTALIRC antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 9619577;

  3. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508135

    Description: epitope description:PSFPTQRTSKTLKVLTPPIT antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  4. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508148

    Description: epitope description:LQSSSFIFHKFQTKAYHPSF antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  5. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508149

    Description: epitope description:YHPSFLLSHGLIQYSSFHSL antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  6. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508161

    Description: epitope description:AEIRGERK antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR69

    Publication: 7519806;

  7. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508168

    Description: epitope description:DSWDHEQA antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR76

    Publication: 7519806;

  8. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508170

    Description: epitope description:SLVGDKLY antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR77

    Publication: 7519806;

  9. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508173

    Description: epitope description:AEIRGERK antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR69

    Publication: 7519806;

  10. Human parainfluenza virus type 2 phosphoprotein: mapping of monoclonal antibody epitopes and location of the multimerization domain.

    ID: 1508176

    Description: epitope description:MAEEPTYTTEQVDELIHAGLGTVDFFLSRPIDAQSSLGKGSIPPGVT antigen name:Human rubulavirus 2 protein host organism:Mus musculus antibody name:...

    Publication: 9191922;

  11. Analysis of the newly identified neutralization epitopes on VP7 of human rotavirus serotype 1.

    ID: 1508179

    Description: epitope description:Q104, D145, M217 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:K8-3C10

    Publication: 1703558;

  12. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508193

    Description: epitope description:SRSLPRQSLIQPPTFHPPSS antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;

  13. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508195

    Description: epitope description:MDTWNPPLGSTSQPCLFQTP antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;

  14. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508212

    Description: epitope description:TKDTNNNLCGN host organism:Mus musculus BALB/c

    Publication: 12729743;

  15. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508214

    Description: epitope description:TKDTNNNLCG + D-aa(C9) host organism:Mus musculus BALB/c

    Publication: 12729743;

  16. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508215

    Description: epitope description:TKDTNNNLCG + D-aa(C9) host organism:Mus musculus BALB/c

    Publication: 12729743;

  17. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508224

    Description: epitope description:SPGGLEPPSEKHFRETEV antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  18. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508233

    Description: epitope description:TKDTNNNLCGN host organism:Mus musculus BALB/c

    Publication: 12729743;

  19. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508242

    Description: epitope description:TGAPSLGDYVRPAYIVTPYW antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;

  20. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508243

    Description: epitope description:TGAPSLGDYVRPAYIVTPYW antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston