Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Human parainfluenza virus type 2 phosphoprotein: mapping of monoclonal antibody epitopes and location of the multimerization domain.

    ID: 1508259

    Description: epitope description:ANDCISRPDTKTEFVTKIQAATTESQLNEIKRSIIRSAI antigen name:Human rubulavirus 2 protein host organism:Mus musculus antibody name:2-1A, 5A...

    Publication: 9191922;

  2. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508404

    Description: epitope description:STNPKPQRKTKRNTNRRPQD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  3. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508409

    Description: epitope description:PRGSRPSWGPTDPRRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  4. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508413

    Description: epitope description:LPGCSFSIFLLALLSCLTIPASA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  5. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508429

    Description: epitope description:SRGNHVSPTHYVPESDAAAR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  6. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508434

    Description: epitope description:KLYVCLNE antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR77

    Publication: 7519806;

  7. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508436

    Description: epitope description:TATKQAEAAAPVVESKWRA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  8. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508437

    Description: epitope description:KSKKCPMGFSYDTRCFDSTVTENDIRTEES antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  9. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508441

    Description: epitope description:VKFPGGGQIVGGVYLLPRRG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  10. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508442

    Description: epitope description:RKTSERSQPRGRRQPIPKARRPEGR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  11. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508448

    Description: epitope description:PPALPIWARPDYNPPLLESWKDPD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  12. Localization of antigenic domains on the major subunits of Bordetella pertussis serotype 2 and 3 fimbriae.

    ID: 1508470

    Description: epitope description:KVTNGSKSYTLRYLASYVK antigen name:Serotype 3 fimbrial subunit host organism:Mus musculus Porton

    Publication: 7512870;

  13. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508477

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  14. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508486

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  15. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508487

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  16. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508491

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  17. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508500

    Description: epitope description:FGMLPVPQQPMGPQ antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;

  18. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508501

    Description: epitope description:QPMGPQPMGPQPMEP antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;

  19. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508509

    Description: epitope description:FGMLPVPQQPMGPQ antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;

  20. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508510

    Description: epitope description:QPMEPQPLPMGPQ antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston