N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

ID: 1851623

Description: epitope description:GRQPTPLSPPLRNTH antigen name:Large envelope protein host organism:Mus musculus BALB/c

N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus.

ID: 1851627

Description: epitope description:LSPPLRNTHPQAMQW antigen name:Large envelope protein host organism:Mus musculus BALB/c

Combined CD4 T-cell and antibody response to human minor histocompatibility antigen DBY after allogeneic stem-cell transplantation.

ID: 1851636

Description: epitope description:ENALGLDQQFAGLDLNSSD antigen name:ATP-dependent RNA helicase DDX3X host organism:Homo sapiens

Synthesis and antigenic properties of C-7-modified Kdo mono- and disaccharide ligands and Kdo disaccharide interresidue lactones.

ID: 1851652

Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S2...

Use of affinity-directed liquid chromatography-mass spectrometry to map the epitopes of a factor VIII inhibitor antibody fraction.

ID: 1851670

Description: epitope description:KDFPILPGEIF antigen name:Coagulation factor VIII host organism:Homo sapiens

Use of affinity-directed liquid chromatography-mass spectrometry to map the epitopes of a factor VIII inhibitor antibody fraction.

ID: 1851674

Description: epitope description:SWYLTENIQR antigen name:Coagulation factor VIII host organism:Homo sapiens

Use of affinity-directed liquid chromatography-mass spectrometry to map the epitopes of a factor VIII inhibitor antibody fraction.

ID: 1851681

Description: epitope description:VTGVTTQGVK antigen name:Coagulation factor VIII host organism:Homo sapiens

Distinct conformational states of HIV-1 gp41 are recognized by neutralizing and non-neutralizing antibodies.

ID: 1927509

Description: epitope description:H633, Y636, E637, E640, Q643, K644, E647, K648, Q651 antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody ...

Functional significance of five noncanonical Ca2+-binding sites of human transglutaminase 2 characterized by site-directed mutagenesis.

ID: 1927561

Description: epitope description:D306, N308, N310 antigen name:Protein-glutamine gamma-glutamyltransferase 2 host organism:Homo sapiens

Structural basis of HIV-1 neutralization by affinity matured Fabs directed against the internal trimeric coiled-coil of gp41.

ID: 1927564

Description: epitope description:E560, Q563, H564, L565, Q567, L568, W571, G572, K574, Q575, L576, R579, M629, D632, N636, S640, H643, I646, E647, V570, I573, K574...

Foot-and-mouth disease virus epitope dominance in the antibody response of vaccinated animals.

ID: 1927592

Description: epitope description:Q873 antigen name:Polyprotein host organism:Bos taurus

Antigen-capture ELISA for the detection of Rift Valley fever virus nucleoprotein using new monoclonal antibodies.

ID: 1927611

Description: epitope description:TFTQPMN antigen name:Rift Valley fever phlebovirus protein host organism:Mus musculus BALB/c antibody name:G2-36, D5-59

Immunological features and the ability of inhibitory effects on enzymatic activity of an epitope vaccine composed of cholera toxin B subunit and B cel...

ID: 1927696

Description: epitope description:SVELIDIGGNRRIFGFNALVD antigen name:Urease subunit alpha host organism:Mus musculus BALB/c

Immunological features and the ability of inhibitory effects on enzymatic activity of an epitope vaccine composed of cholera toxin B subunit and B cel...

ID: 1927699

Description: epitope description:SVELIDIGGNRRIFGFNALVD antigen name:Urease subunit alpha host organism:Rattus norvegicus Sprague-Dawley

Immunological features and the ability of inhibitory effects on enzymatic activity of an epitope vaccine composed of cholera toxin B subunit and B cel...

ID: 1927701

Description: epitope description:SVELIDIGGNRRIFGFNALVD antigen name:Urease subunit alpha host organism:Rattus norvegicus Sprague-Dawley

Immunological features and the ability of inhibitory effects on enzymatic activity of an epitope vaccine composed of cholera toxin B subunit and B cel...

ID: 1927703

Description: epitope description:SVELIDIGGNRRIFGFNALVD antigen name:Urease subunit alpha host organism:Mus musculus BALB/c

Biotin sulfone as a new tool for synthetic oligosaccharide immobilization: application to multiple analysis profiling and surface plasmonic analysis o...

ID: 1927707

Description: epitope description:alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man antigen name:mannan host organism:Rattus norvegicus LOU antib...

Computational design of epitope-scaffolds allows induction of antibodies specific for a poorly immunogenic HIV vaccine epitope.

ID: 1927721

Description: epitope description:NWFDITNWLWYIR antigen name:Envelope glycoprotein gp160 host organism:Oryctolagus cuniculus

How protein recognizes ladder-like polycyclic ethers. Interactions between ciguatoxin (CTX3C) fragments and its specific antibody 10C9.

ID: 1927725

Description: epitope description:(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol anti...

Plant-based expression of a partially humanized neutralizing monoclonal IgG directed against an immunodominant epitope on the ricin toxin A subunit.

ID: 1927739

Description: epitope description:TLARSFIICIQM antigen name:Ricin homolog, truncated host organism:Mus musculus BALB/c antibody name:cGD12

Plant-based expression of a partially humanized neutralizing monoclonal IgG directed against an immunodominant epitope on the ricin toxin A subunit.

ID: 1927742

Description: epitope description:TLARSFIICIQM antigen name:Ricin homolog, truncated host organism:Mus musculus BALB/c antibody name:cGD12, mGD12

Plant-based expression of a partially humanized neutralizing monoclonal IgG directed against an immunodominant epitope on the ricin toxin A subunit.

ID: 1927745

Description: epitope description:TLARSFIICIQM antigen name:Ricin homolog, truncated host organism:Mus musculus BALB/c antibody name:mGD12

Plant-based expression of a partially humanized neutralizing monoclonal IgG directed against an immunodominant epitope on the ricin toxin A subunit.

ID: 1927760

Description: epitope description:SVYDVSILIPII antigen name:Ricin homolog, truncated host organism:Mus musculus BALB/c antibody name:mGD12

DNA immunization with HBsAg-based particles expressing a B cell epitope of amyloid beta-peptide attenuates disease progression and prolongs survival i...

ID: 1927808

Description: epitope description:DAEFRHDSGYE antigen name:Amyloid beta A4 protein host organism:Mus musculus C57BL/6

Crystal structure and size-dependent neutralization properties of HK20, a human monoclonal antibody binding to the highly conserved heptad repeat 1 of...

ID: 1927813

Description: epitope description:H564, L565, Q567, L568, T569, W571, G572, K574, Q575, A578, R579, H643, V570, I573, K574, Q577 antigen name:Envelope glycoprotein ...

Evaluation of novel Streptococcus pyogenes vaccine candidates incorporating multiple conserved sequences from the C-repeat region of the M-protein.

ID: 1927850

Description: epitope description:KQAEDKVKASREAKKQVEKALEQLEDKVK host organism:Mus musculus B10.BR

Identification of B-cell epitopes in the NSP1 protein of porcine reproductive and respiratory syndrome virus.

ID: 1927863

Description: epitope description:EEPLRW antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:4H2

Identification of B-cell epitopes in the NSP1 protein of porcine reproductive and respiratory syndrome virus.

ID: 1927864

Description: epitope description:HVLTNLP antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:2G5, 3E11, 4D4

Identification of B-cell epitopes in the NSP1 protein of porcine reproductive and respiratory syndrome virus.

ID: 1927866

Description: epitope description:EEPLRW antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:4H2

Monitoring of gluten-free diet compliance in celiac patients by assessment of gliadin 33-mer equivalent epitopes in feces.

ID: 1927886

Description: epitope description:LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musc...

Evaluation of novel Streptococcus pyogenes vaccine candidates incorporating multiple conserved sequences from the C-repeat region of the M-protein.

ID: 1927887

Description: epitope description:KQAEDKVKASREAKKQVEKALEQLEDKVK host organism:Mus musculus B10.BR

Evaluation of novel Streptococcus pyogenes vaccine candidates incorporating multiple conserved sequences from the C-repeat region of the M-protein.

ID: 1927888

Description: epitope description:KQAEDKVKASREAKKQVEKALEQLEDKVK host organism:Mus musculus B10.BR

Evaluation of novel Streptococcus pyogenes vaccine candidates incorporating multiple conserved sequences from the C-repeat region of the M-protein.

ID: 1927894

Description: epitope description:ASREAKKKVEADLAASREAKKQVEKALEASREAKKKVEADLAASREAKKQVEKALE host organism:Mus musculus B10.BR

Evaluation of novel Streptococcus pyogenes vaccine candidates incorporating multiple conserved sequences from the C-repeat region of the M-protein.

ID: 1927895

Description: epitope description:ASREAKKKVEADLAASREAKKQVEKALEASREAKKKVEADLAASREAKKQVEKALE host organism:Mus musculus B10.BR

Evaluation of novel Streptococcus pyogenes vaccine candidates incorporating multiple conserved sequences from the C-repeat region of the M-protein.

ID: 1927902

Description: epitope description:KQAEDKVKASREAKKQVEKALEQLEDKVK host organism:Mus musculus B10.BR

A nonself sugar mimic of the HIV glycan shield shows enhanced antigenicity.

ID: 1927911

Description: epitope description:beta-D-fructopyranose host organism:Homo sapiens antibody name:2G12

Recombinant dengue type 2 viruses with altered e protein domain III epitopes are efficiently neutralized by human immune sera.

ID: 1928033

Description: epitope description:T55, E71, L107, H244 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:DV2-30

CD8+ T cells mediate the athero-protective effect of immunization with an ApoB-100 peptide.

ID: 1928041

Description: epitope description:KTTKQSFDLSVKAQYKKNKH antigen name:Apolipoprotein B-100 host organism:Mus musculus Apolipoprotein E null

Structural definition of a conserved neutralization epitope on HIV-1 gp120.

ID: 1928129

Description: epitope description:C119, V120, L122, V200, T202, Q203, A204, C205, R419, K421, Q422, I423, M434, P437 antigen name:Envelope glycoprotein gp160 host o...

Gantenerumab: a novel human anti-Abeta antibody demonstrates sustained cerebral amyloid-beta binding and elicits cell-mediated removal of human amyloi...

ID: 1928157

Description: epitope description:VFFAEDVGSN antigen name:Amyloid beta A4 protein host organism:Homo sapiens antibody name:gantenerumab

Structural insights into the neutralization mechanism of a higher primate antibody against dengue virus.

ID: 1928230

Description: epitope description:V160, T161, A162, M163, S168, S170, V171, E172, V173, K174, P176, D177, G179, E180, K291, R293 antigen name:Genome polyprotein hos...

Structural insights into the neutralization mechanism of a higher primate antibody against dengue virus.

ID: 1928231

Description: epitope description:V160, T161, A162, M163, S168, S170, V171, E172, V173, K174, P176, D177, G179, E180, K291, R293 antigen name:Genome polyprotein hos...

Induction of insert-specific immune response in mice by hamster polyomavirus VP1 derived virus-like particles carrying LCMV GP33 CTL epitope.

ID: 1928665

Description: epitope description:KAVYNFATM antigen name:Pre-glycoprotein polyprotein GP complex host organism:Mus musculus C57BL/6

Crystal structure of a non-neutralizing antibody to the HIV-1 gp41 membrane-proximal external region.

ID: 1928672

Description: epitope description:LLELDKWASLW + AMID(W11) antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

Crystal structure of a non-neutralizing antibody to the HIV-1 gp41 membrane-proximal external region.

ID: 1928673

Description: epitope description:LLELDKWASLW + AMID(W11) antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

Crystal structure of a non-neutralizing antibody to the HIV-1 gp41 membrane-proximal external region.

ID: 1928674

Description: epitope description:LLELDKWASLW + AMID(W11) antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

Rational development of high-affinity T-cell receptor-like antibodies.

ID: 1929072

Description: epitope description:SLLMWITQV host organism:Homo sapiens antibody name:3M4E5

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929084

Description: epitope description:IHNDVEAWMDRYKYYP antigen name:Genome polyprotein host organism:Gallus gallus

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929086

Description: epitope description:IHNDVEAWMDRYKYYP antigen name:Genome polyprotein host organism:Anser sp.

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929088

Description: epitope description:IHNDVEAWMDRYKYYP antigen name:Genome polyprotein host organism:Aves

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929091

Description: epitope description:RYKYYPETPQGLAKII antigen name:Genome polyprotein host organism:Gallus gallus

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929093

Description: epitope description:RYKYYPETPQGLAKII antigen name:Genome polyprotein host organism:Anser sp.

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929095

Description: epitope description:GLAKIIQKAHKEGVCG antigen name:Genome polyprotein host organism:Anas platyrhynchos

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929100

Description: epitope description:SRLEHQMWEAVKDELN antigen name:Genome polyprotein host organism:Gallus gallus

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929106

Description: epitope description:ENGVDLSVVVEKQEGM antigen name:Genome polyprotein host organism:Gallus gallus

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929110

Description: epitope description:EKQEGMYKSAPKRLTA antigen name:Genome polyprotein host organism:Anas platyrhynchos

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929111

Description: epitope description:EKQEGMYKSAPKRLTA antigen name:Genome polyprotein host organism:Anser sp.

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929113

Description: epitope description:PKRLTATTEKLEIGWK antigen name:Genome polyprotein host organism:Anas platyrhynchos

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929121

Description: epitope description:NTFVVDGPETKECPTQ antigen name:Genome polyprotein host organism:Gallus gallus

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929122

Description: epitope description:NTFVVDGPETKECPTQ antigen name:Genome polyprotein host organism:Anas platyrhynchos

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929128

Description: epitope description:KECPTQNRAWNSLEVE antigen name:Genome polyprotein host organism:Gallus gallus

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929135

Description: epitope description:GLTSTRMFLKVRESNT antigen name:Genome polyprotein host organism:Anas platyrhynchos

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929141

Description: epitope description:SKIIGTAVKNNLAIHS antigen name:Genome polyprotein host organism:Anas platyrhynchos

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929153

Description: epitope description:KSCTWPETHTLWGDGI antigen name:Genome polyprotein host organism:Anas platyrhynchos

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929157

Description: epitope description:LWGDGILESDLIIPVT antigen name:Genome polyprotein host organism:Anser sp.

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929158

Description: epitope description:LWGDGILESDLIIPVT antigen name:Genome polyprotein host organism:Aves

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929159

Description: epitope description:LWGDGILESDLIIPVT antigen name:Genome polyprotein host organism:Aves

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929177

Description: epitope description:CGHRGPATRTTTESGK antigen name:Genome polyprotein host organism:Gallus gallus

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929183

Description: epitope description:WCCRSCTLPPLRYQTD antigen name:Genome polyprotein host organism:Gallus gallus

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929193

Description: epitope description:DEKTLVQSQVNA antigen name:Genome polyprotein host organism:Anas platyrhynchos

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929198

Description: epitope description:VHNDVEAWVDRYKYLP antigen name:Genome polyprotein host organism:Gallus gallus

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929203

Description: epitope description:IHNDVEAWIDRYKYLP antigen name:Genome polyprotein host organism:Anser sp.

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929208

Description: epitope description:NTFVIDGPETKECPTQ antigen name:Genome polyprotein host organism:Anas platyrhynchos

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929209

Description: epitope description:NTFVIDGPETKECPTQ antigen name:Genome polyprotein host organism:Anser sp.

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929213

Description: epitope description:STFVVDGPETAECPNS antigen name:Genome polyprotein host organism:Gallus gallus

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929221

Description: epitope description:LWGDGVLESDLIIPIT antigen name:Genome polyprotein host organism:Anser sp.

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929223

Description: epitope description:LWGDGVEESELIIPHT antigen name:Genome polyprotein host organism:Anas platyrhynchos

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929228

Description: epitope description:LWGDGVVESEMIIPVT antigen name:polyprotein host organism:Gallus gallus

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929229

Description: epitope description:LWGDGVVESEMIIPVT antigen name:polyprotein host organism:Anas platyrhynchos

Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

ID: 1929230

Description: epitope description:LWGDGVVESEMIIPVT antigen name:polyprotein host organism:Anser sp.

Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

ID: 1929232

Description: epitope description:PALDAAETGHTSSVQPEDMIETRYVITDQTRDET antigen name:Genome polyprotein host organism:Homo sapiens

Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

ID: 1929234

Description: epitope description:NPVENYIDSVLNEVLVVPNIQ antigen name:Genome polyprotein host organism:Homo sapiens

Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

ID: 1929237

Description: epitope description:QPEDMIETRYVITDQTRDET antigen name:Genome polyprotein host organism:Homo sapiens

Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

ID: 1929239

Description: epitope description:CIAMIEFNTSSDKTEHDKIG antigen name:Genome polyprotein host organism:Homo sapiens

Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

ID: 1929293

Description: epitope description:VVPNIQPSTSVSSHAAPALD antigen name:Genome polyprotein host organism:Cavia porcellus

Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

ID: 1929299

Description: epitope description:TRDETSIESFLGRSGCIAMI antigen name:Genome polyprotein host organism:Cavia porcellus

Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

ID: 1929301

Description: epitope description:CIAMIEFNTSSDKTEHDKIG antigen name:Genome polyprotein host organism:Cavia porcellus

Synthesis-based approach toward direct sandwich immunoassay for ciguatoxin CTX3C.

ID: 1929339

Description: epitope description:(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol anti...

Synthesis-based approach toward direct sandwich immunoassay for ciguatoxin CTX3C.

ID: 1929341

Description: epitope description:(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol anti...

Development of monoclonal antibodies to recombinant terrelysin and characterization of expression in Aspergillus terreus.

ID: 1929346

Description: epitope description:PSNEFE antigen name:Terrelysin host organism:Mus musculus BALB/c antibody name:13G10, 10G4

Development of monoclonal antibodies to recombinant terrelysin and characterization of expression in Aspergillus terreus.

ID: 1929348

Description: epitope description:PSNEFE antigen name:Terrelysin host organism:Mus musculus BALB/c antibody name:13G10, 10G4

Development of monoclonal antibodies to recombinant terrelysin and characterization of expression in Aspergillus terreus.

ID: 1929354

Description: epitope description:LYEGQFHS antigen name:Terrelysin host organism:Mus musculus BALB/c antibody name:15B5

Development of monoclonal antibodies to recombinant terrelysin and characterization of expression in Aspergillus terreus.

ID: 1929359

Description: epitope description:PSNEFE antigen name:Terrelysin host organism:Mus musculus BALB/c antibody name:13G10, 10G4

Development of monoclonal antibodies to recombinant terrelysin and characterization of expression in Aspergillus terreus.

ID: 1929361

Description: epitope description:LYEGQFHS antigen name:Terrelysin host organism:Mus musculus BALB/c antibody name:15B5

A cross-protective mAb recognizes a novel epitope within the flavivirus NS1 protein.

ID: 1929383

Description: epitope description:KAWGKSILFA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:16NS1

A highly alpha-stereoselective synthesis of oligosaccharide fragments of the Vi antigen from Salmonella typhi and their antigenic activities.

ID: 1929395

Description: epitope description:3-O-Ac-alpha-D-GalpANAc-(1->4)-3-O-Ac-alpha-D-GalpANAc antigen name:[4)-3-O-Ac-alpha-D-GalpANAc(1->]n host organism:Oryctolagus cu...

A highly alpha-stereoselective synthesis of oligosaccharide fragments of the Vi antigen from Salmonella typhi and their antigenic activities.

ID: 1929396

Description: epitope description:3-O-Ac-alpha-D-GalpANAc-(1->4)-3-O-Ac-alpha-D-GalpANAc-(1->4)-3-O-Ac-alpha-D-GalpANAc antigen name:[4)-3-O-Ac-alpha-D-GalpANAc(1->...

Helicobacter pylori isolates from Greek children express type 2 and type 1 Lewis and alpha1,6-glucan antigens in conjunction with a functional type IV...

ID: 1929400

Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc antigen name:lipopolysaccharide host organism:Mus musculus antibody name:P...

Genetic mapping of a highly variable norovirus GII.4 blockade epitope: potential role in escape from human herd immunity.

ID: 1929502

Description: epitope description:V294, S296, H297, D298, T368, N372 antigen name:Capsid protein VP1 host organism:Homo sapiens

Bacterial Toxin Fusion Proteins Elicit Mucosal Immunity against a Foot-and-Mouth Disease Virus Antigen When Administered Intranasally to Guinea Pigs.

ID: 1929717

Description: epitope description:RYSRNAVPNLRGDLQVLAQKVART antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley