Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Preparation and initial application of a monoclonal antibody specific for a newly discovered conserved linear epitope of rabies virus nucleoprotein.

    ID: 1929732

    Description: epitope description:KISGQNTGNYKTN antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:RVNP-mAb1

    Publication: 22424633;

  2. Glycolipid- and glycoprotein-based blood group A antigen expression in human thrombocytes. A1/A2 difference.

    ID: 1929740

    Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp antigen name:glycoprotein host organism:Mus musculus antibody name:Seracl...

    Publication: 2136356;

  3. A human antibody recognizing a conserved epitope of H5 hemagglutinin broadly neutralizes highly pathogenic avian influenza H5N1 viruses.

    ID: 1929742

    Description: epitope description:P134, S137, K177, Y180, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:65C6

    Publication: 22238297;

  4. A human antibody recognizing a conserved epitope of H5 hemagglutinin broadly neutralizes highly pathogenic avian influenza H5N1 viruses.

    ID: 1929746

    Description: epitope description:P134, S137, K177, Y180, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:65C6

    Publication: 22238297;

  5. A human antibody recognizing a conserved epitope of H5 hemagglutinin broadly neutralizes highly pathogenic avian influenza H5N1 viruses.

    ID: 1929749

    Description: epitope description:P134, S137, K177, Y180, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:65C6

    Publication: 22238297;

  6. A human antibody recognizing a conserved epitope of H5 hemagglutinin broadly neutralizes highly pathogenic avian influenza H5N1 viruses.

    ID: 1929752

    Description: epitope description:P134, S137, K177, Y180, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:65C6

    Publication: 22238297;

  7. A human antibody recognizing a conserved epitope of H5 hemagglutinin broadly neutralizes highly pathogenic avian influenza H5N1 viruses.

    ID: 1929790

    Description: epitope description:P134, S137, K177, Y180, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:65C6

    Publication: 22238297;

  8. A human antibody recognizing a conserved epitope of H5 hemagglutinin broadly neutralizes highly pathogenic avian influenza H5N1 viruses.

    ID: 1929794

    Description: epitope description:P134, S137, K177, Y180, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:65C6

    Publication: 22238297;

  9. A human antibody recognizing a conserved epitope of H5 hemagglutinin broadly neutralizes highly pathogenic avian influenza H5N1 viruses.

    ID: 1929797

    Description: epitope description:P134, S137, K177, Y180, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:65C6

    Publication: 22238297;

  10. A human antibody recognizing a conserved epitope of H5 hemagglutinin broadly neutralizes highly pathogenic avian influenza H5N1 viruses.

    ID: 1929800

    Description: epitope description:P134, S137, K177, Y180, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:65C6

    Publication: 22238297;

  11. A human antibody recognizing a conserved epitope of H5 hemagglutinin broadly neutralizes highly pathogenic avian influenza H5N1 viruses.

    ID: 1929812

    Description: epitope description:P134, S137, K177, Y180, T183 antigen name:Hemagglutinin host organism:Homo sapiens

    Publication: 22238297;

  12. Anti-Gal titers in healthy adults and inflammatory bowel disease patients.

    ID: 1929822

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 22172880;

  13. Characterization and specificity of the linear epitope of the enterovirus 71 VP2 protein.

    ID: 1930112

    Description: epitope description:EDSHP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:7C7

    Publication: 22361222;

  14. Characterization and specificity of the linear epitope of the enterovirus 71 VP2 protein.

    ID: 1930117

    Description: epitope description:ENSHPP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:7C7

    Publication: 22361222;

  15. Characterization and specificity of the linear epitope of the enterovirus 71 VP2 protein.

    ID: 1930118

    Description: epitope description:ENSHPP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:7C7

    Publication: 22361222;

  16. Characterization and specificity of the linear epitope of the enterovirus 71 VP2 protein.

    ID: 1930122

    Description: epitope description:EDSHP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:7C7

    Publication: 22361222;

  17. Structural aspects of human leukocyte antigen class I epitopes detected by human monoclonal antibodies.

    ID: 1930169

    Description: epitope description:T62 antigen name:HLA class I histocompatibility antigen, B-44 alpha chain host organism:Homo sapiens Caucasian antibody name:ROU9A...

    Publication: 22227099;

  18. Structural aspects of human leukocyte antigen class I epitopes detected by human monoclonal antibodies.

    ID: 1930182

    Description: epitope description:E100, R103, I104, L106, R107 antigen name:HLA class I histocompatibility antigen, B-49 alpha chain host organism:Homo sapiens Cauc...

    Publication: 22227099;

  19. Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

    ID: 1930187

    Description: epitope description:LDLERDARVRAERNANEMSI antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22015270;

  20. Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

    ID: 1930190

    Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22015270;

  21. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936249

    Description: epitope description:LLVAMIPEYLSTAQQDFLGSWRDKTTDSTPGTWVWNTYEAFPPGFPP antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 21930350;

  22. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936251

    Description: epitope description:SGDTPLNIFSTLHRKLDNSVRDY antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 21930350;

  23. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936253

    Description: epitope description:LPTSYCGYSDYTRPQDTFGVA antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 21930350;

  24. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936254

    Description: epitope description:VNARPLTQLKGADDEP antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 21930350;

  25. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936259

    Description: epitope description:SGDTLLAPFYMPNHKLDKNTRDY antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 21930350;

  26. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936269

    Description: epitope description:SGDTQLNPFVTPNFKLDKTVRDY antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 21930350;

  27. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936271

    Description: epitope description:DDPSTTSDARKMPVIHSVSHT antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 21930350;

  28. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936279

    Description: epitope description:SDPSETSDSHSFAMPNVVSHT antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  29. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936287

    Description: epitope description:LLVVMVPEYVATSQTDFRGSWQDKDTDNLPGAWMWQTYDALPSTLPP antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  30. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936296

    Description: epitope description:tiaprofenic acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  31. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936301

    Description: epitope description:tiaprofenic acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  32. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936310

    Description: epitope description:hydroxy(phenyl)2-thienylacetic acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  33. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936311

    Description: epitope description:hydroxy(phenyl)2-thienylacetic acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  34. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936317

    Description: epitope description:hydroxy(phenyl)2-thienylacetic acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  35. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936318

    Description: epitope description:hydroxy(phenyl)2-thienylacetic acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  36. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936362

    Description: epitope description:4-(5-ethyl-2-thienyl)-4-oxobutyric acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  37. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936366

    Description: epitope description:suprofen host organism:Oryctolagus cuniculus

    Publication: 11712905;

  38. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936370

    Description: epitope description:suprofen host organism:Oryctolagus cuniculus

    Publication: 11712905;

  39. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936395

    Description: epitope description:4-oxo-4-phenylbutyric acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  40. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936403

    Description: epitope description:4-oxo-4-(2-thienyl)butyric acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  41. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1936411

    Description: epitope description:decarboxytiaprofenic acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  42. Fine epitope specificity of anti-erythropoietin antibodies reveals molecular mimicry with HIV-1 p17 protein: a pathogenetic mechanism for HIV-1-relate...

    ID: 1936435

    Description: epitope description:GLALLSEAVLRGQALLVNSS antigen name:Erythropoietin host organism:Homo sapiens

    Publication: 21849287;

  43. Identification of two immunoreactive peptides useful for the detection of porcine astrovirus.

    ID: 1937617

    Description: epitope description:SLNPTATPSSTGWSGLG antigen name:capsid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21734352;

  44. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937647

    Description: epitope description:KAPAFNL host organism:Homo sapiens

    Publication: 22555070;

  45. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937648

    Description: epitope description:KLIAFDL host organism:Homo sapiens

    Publication: 22555070;

  46. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937678

    Description: epitope description:KLPAFML host organism:Homo sapiens

    Publication: 22555070;

  47. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937683

    Description: epitope description:KQPAFNL host organism:Homo sapiens

    Publication: 22555070;

  48. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937685

    Description: epitope description:KTAAFNL host organism:Homo sapiens

    Publication: 22555070;

  49. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937690

    Description: epitope description:SPPRGIF host organism:Homo sapiens

    Publication: 22555070;

  50. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937695

    Description: epitope description:DSPRGVF host organism:Homo sapiens

    Publication: 22555070;

  51. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937696

    Description: epitope description:MSDRGIF host organism:Homo sapiens

    Publication: 22555070;

  52. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937698

    Description: epitope description:SPIISHY host organism:Homo sapiens

    Publication: 22555070;

  53. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937699

    Description: epitope description:SPILAHY host organism:Homo sapiens

    Publication: 22555070;

  54. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937700

    Description: epitope description:SPITLYY host organism:Homo sapiens

    Publication: 22555070;

  55. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937701

    Description: epitope description:VPPRGLF host organism:Homo sapiens

    Publication: 22555070;

  56. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937705

    Description: epitope description:LPPRGLF host organism:Homo sapiens

    Publication: 22555070;

  57. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937712

    Description: epitope description:FSPIIAF host organism:Homo sapiens

    Publication: 22555070;

  58. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937722

    Description: epitope description:EWSRGIF host organism:Homo sapiens

    Publication: 22555070;

  59. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937742

    Description: epitope description:VLPGSKS host organism:Homo sapiens

    Publication: 22555070;

  60. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937745

    Description: epitope description:ACCRSIP host organism:Homo sapiens

    Publication: 22555070;

  61. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937746

    Description: epitope description:AVESNDK host organism:Homo sapiens

    Publication: 22555070;

  62. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937751

    Description: epitope description:TPFSNSP host organism:Homo sapiens

    Publication: 22555070;

  63. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938204

    Description: epitope description:GFLSELTQQLAQATGKPP antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens

    Publication: 22238348;

  64. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938210

    Description: epitope description:QLMAFGGSSE antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxH08

    Publication: 22238348;

  65. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938223

    Description: epitope description:NYYDMNAANVGWNNSTFA antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxF07

    Publication: 22238348;

  66. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938235

    Description: epitope description:NYYDMNAANVGWNNSTFA antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxF07

    Publication: 22238348;

  67. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938238

    Description: epitope description:ERLRISPDRVYINYYDMN antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxD08

    Publication: 22238348;

  68. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938240

    Description: epitope description:ERLRISPDRVYINYYDMN antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxD08

    Publication: 22238348;

  69. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938247

    Description: epitope description:ERLRISPDRVYINYYDMN antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxG03

    Publication: 22238348;

  70. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938250

    Description: epitope description:FGGSSEPCALCSLHSIGKI antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens

    Publication: 22238348;

  71. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938255

    Description: epitope description:ERLRISPDRVYINYYDMN antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens

    Publication: 22238348;

  72. A pan-H1 anti-hemagglutinin monoclonal antibody with potent broad-spectrum efficacy in vivo.

    ID: 1938307

    Description: epitope description:A388 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:6F12

    Publication: 22491456;

  73. A pan-H1 anti-hemagglutinin monoclonal antibody with potent broad-spectrum efficacy in vivo.

    ID: 1938308

    Description: epitope description:A388 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:6F12

    Publication: 22491456;

  74. A pan-H1 anti-hemagglutinin monoclonal antibody with potent broad-spectrum efficacy in vivo.

    ID: 1938316

    Description: epitope description:A388 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:6F12

    Publication: 22491456;

  75. A pan-H1 anti-hemagglutinin monoclonal antibody with potent broad-spectrum efficacy in vivo.

    ID: 1938320

    Description: epitope description:A388 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 22491456;

  76. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1938844

    Description: epitope description:VRNVDLLPEQTKKEDDP antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 21930350;

  77. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1938853

    Description: epitope description:LLVVMVPEYVAEQQRDFRGSWQDKDSDGLPGEWKWQSYDALPRHLPP antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  78. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938873

    Description: epitope description:A54, T55, L56, R57, V129, Q131, P132, E133, N134, P166, K246, K247 antigen name:Genome polyprotein host organism:Homo sapiens anti...

    Publication: 22509258;

  79. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938888

    Description: epitope description:P54, L56, Q58, N59, P61, W67 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:D29

    Publication: 22509258;

  80. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938896

    Description: epitope description:P54, L56, Q58, N59, P61, W67 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:D29

    Publication: 22509258;

  81. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938898

    Description: epitope description:P54, L56, Q58, N59, P61, W67 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:D29

    Publication: 22509258;

  82. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938916

    Description: epitope description:GRLTTVNPIVT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4G2

    Publication: 22509258;

  83. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938918

    Description: epitope description:GRLTTVNPIVT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4G2

    Publication: 22509258;

  84. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938928

    Description: epitope description:PGFTVMAAIL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2H2

    Publication: 22509258;

  85. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938930

    Description: epitope description:GRLTTVNPIVT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4G2

    Publication: 22509258;

  86. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938933

    Description: epitope description:GRLTTVNPIVT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4G2

    Publication: 22509258;

  87. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938946

    Description: epitope description:K305, P384 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3H5

    Publication: 22509258;

  88. Anaphylaxis to pork kidney is related to IgE antibodies specific for galactose-alpha-1,3-galactose.

    ID: 1939066

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose antigen name:glycoprotein host organism:Mus musculus antibody name:M86

    Publication: 22494361;

  89. Anaphylaxis to pork kidney is related to IgE antibodies specific for galactose-alpha-1,3-galactose.

    ID: 1939070

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose antigen name:glycoprotein host organism:Mus musculus antibody name:M86

    Publication: 22494361;

  90. Anaphylaxis to pork kidney is related to IgE antibodies specific for galactose-alpha-1,3-galactose.

    ID: 1939076

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose antigen name:glycoprotein host organism:Mus musculus antibody name:M86

    Publication: 22494361;

  91. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1939077

    Description: epitope description:tiaprofenic acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  92. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1939094

    Description: epitope description:VRNVELGPEKKDKKDDP antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  93. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939095

    Description: epitope description:EQDRKPRN antigen name:Envelope glycoprotein B host organism:Mus musculus

    Publication: 22649465;

  94. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939104

    Description: epitope description:GRTDRPSA antigen name:Envelope glycoprotein C host organism:Mus musculus

    Publication: 22649465;

  95. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939108

    Description: epitope description:GRTDRPSA antigen name:Envelope glycoprotein C host organism:Mus musculus

    Publication: 22649465;

  96. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939114

    Description: epitope description:DPPERPDSP antigen name:Envelope glycoprotein E host organism:Mus musculus

    Publication: 22649465;

  97. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939115

    Description: epitope description:DPPERPDSP antigen name:Envelope glycoprotein E host organism:Mus musculus

    Publication: 22649465;

  98. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939119

    Description: epitope description:DPPERPDSP antigen name:Envelope glycoprotein E host organism:Mus musculus

    Publication: 22649465;

  99. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939122

    Description: epitope description:EPPDDDDS antigen name:Envelope glycoprotein G host organism:Mus musculus

    Publication: 22649465;

  100. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939123

    Description: epitope description:EPPDDDDS antigen name:Envelope glycoprotein G host organism:Mus musculus

    Publication: 22649465;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston