Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506775

    Description: epitope description:SIPIGS host organism:Equus caballus

    Publication: 9766888;

  2. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506778

    Description: epitope description:YKGHLH host organism:Equus caballus

    Publication: 9766888;

  3. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506784

    Description: epitope description:TDLRYL host organism:Equus caballus

    Publication: 9766888;

  4. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506788

    Description: epitope description:STLSKS host organism:Equus caballus

    Publication: 9766888;

  5. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506831

    Description: epitope description:KASAMYSGKGPLNDLRVKI antigen name:capsid VP2 host organism:Mus musculus

    Publication: 11562535;

  6. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506867

    Description: epitope description:KKKEEGEDDTARQEIRKAW antigen name:capsid VP2 host organism:Oryctolagus cuniculus

    Publication: 11562535;

  7. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506869

    Description: epitope description:RQEIRKAWVKGMPYMDFSK antigen name:capsid VP2 host organism:Mus musculus

    Publication: 11562535;

  8. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506875

    Description: epitope description:RKRNGVDVDPNKGKWKEHI antigen name:capsid VP2 host organism:Oryctolagus cuniculus

    Publication: 11562535;

  9. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506879

    Description: epitope description:VDVDPNKGKWKEHIKEVTE antigen name:capsid VP2 host organism:Mus musculus

    Publication: 11562535;

  10. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506885

    Description: epitope description:DYGEILTEKVEDLYKGVLL antigen name:capsid VP2 host organism:Mus musculus

    Publication: 11562535;

  11. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1506893

    Description: epitope description:GLPEGTPKDPILRSLAYSNANKECQKLLQA antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1537894;

  12. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1506903

    Description: epitope description:EVDKDISQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLF antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  13. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1506906

    Description: epitope description:GWGLNWDLGLSQWAREALQTGIT antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  14. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506930

    Description: epitope description:LRVKIERDDLSRETIIQII antigen name:capsid VP2 host organism:Oryctolagus cuniculus

    Publication: 11562535;

  15. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506933

    Description: epitope description:KLVEYCDFLTTFVHAKKKE antigen name:capsid VP2 host organism:Oryctolagus cuniculus

    Publication: 11562535;

  16. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506937

    Description: epitope description:RKRNGVDVDPNKGKWKEHI antigen name:capsid VP2 host organism:Oryctolagus cuniculus

    Publication: 11562535;

  17. Localization of a surface domain of the capsid protein of barley yellow dwarf virus.

    ID: 1506965

    Description: epitope description:RKGRGGANPVFRPTGGTEVF antigen name:Major capsid protein host organism:Mus musculus antibody name:P-PAV 1C2, P-PAV 2A5, P-PAV 3A11

    Publication: 1727606;

  18. Protection against measles virus-induced encephalitis by antibodies from mice immunized intranasally with a synthetic peptide immunogen.

    ID: 1506990

    Description: epitope description:INQDPDKILTY antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 9607021;

  19. Identification of the immunodominant T cell epitope of p38, a major egg antigen, and characterization of the epitope-specific Th responsiveness during...

    ID: 1507032

    Description: epitope description:KSDNQIKAVPASQAL antigen name:Putative major egg antigen host organism:Mus musculus CBA/J

    Publication: 9605143;

  20. Definition and mapping of epitopes recognized by specific monoclonal antibodies to Schistosoma bovis 28 kDa glutathione S-transferase: relation with a...

    ID: 1507041

    Description: epitope description:ITDNHGHVKW antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus BALB/c antibody name:Sb4-10

    Publication: 10081767;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston