Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375382

    Description: epitope description:PAAEAHAARSAAVGYYDEEE antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  2. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375386

    Description: epitope description:EERQQNLQQRQQQPPPPARK antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  3. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375395

    Description: epitope description:VSPQVTKASPGRVRRDSAWD antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  4. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375408

    Description: epitope description:ANWPRERAWALKNPHLAYNP antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  5. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375409

    Description: epitope description:KNPHLAYNPFRMPTTSTASQ antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  6. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375412

    Description: epitope description:RAAVTQTASRDAADEVWALR antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  7. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375421

    Description: epitope description:VATPHASARAQTVTSTPVQG antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  8. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375423

    Description: epitope description:EKQVSGTPSTVPATLLQPQP antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  9. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375424

    Description: epitope description:PATLLQPQPASSKTTSSRNV antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  10. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375426

    Description: epitope description:GAGTSSASSARQPSASASVL antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  11. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375440

    Description: epitope description:SPVKSTTGMKTVAFDLSSPQ antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  12. Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

    ID: 1375442

    Description: epitope description:GTGPQPGSAGMGGAKTPSDA antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

    Publication: 1710650;

  13. Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

    ID: 1375448

    Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 9294205;

  14. Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

    ID: 1375458

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 9294205;

  15. Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

    ID: 1375459

    Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 9294205;

  16. Human sera from varicella-zoster virus (VZV) infections cross-react with human T cell leukaemia virus type 1 (HTLV-1): common epitopes in VZV gene 22 ...

    ID: 1375465

    Description: epitope description:SSPTHDPPDS antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens antibody name:HTLV-1 antisera

    Publication: 1279104;

  17. Human sera from varicella-zoster virus (VZV) infections cross-react with human T cell leukaemia virus type 1 (HTLV-1): common epitopes in VZV gene 22 ...

    ID: 1375469

    Description: epitope description:TNIPPPLALLR antigen name:Large tegument protein deneddylase host organism:Homo sapiens antibody name:HTLV-1 antisera

    Publication: 1279104;

  18. Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

    ID: 1375483

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 9294205;

  19. Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

    ID: 1375484

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 9294205;

  20. The dominant linear neutralizing antibody-binding site of glycoprotein gp86 of human cytomegalovirus is strain specific.

    ID: 1375487

    Description: epitope description:LDPHAFHLLL antigen name:Envelope glycoprotein H host organism:Mus musculus BALB/c antibody name:AP86-SA4

    Publication: 1371164;

  21. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370828

    Description: epitope description:RLNNSKIYINGRLIDQKPI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

    Publication: 9488054;

  22. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370830

    Description: epitope description:LNEKEIKDLYDNQSNSGIL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

    Publication: 9488054;

  23. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370836

    Description: epitope description:KKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

    Publication: 9488054;

  24. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370839

    Description: epitope description:YRLATNASQAGVEKILSAL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

    Publication: 9488054;

  25. Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

    ID: 1370846

    Description: epitope description:SRTLGCSWEFIPVDDGWGERPL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:p...

    Publication: 9488054;

  26. Immunogenicity and protective effect against oral colonization by Streptococcus mutans of synthetic peptides of a streptococcal surface protein antige...

    ID: 1370848

    Description: epitope description:LERQMVHTIEVPKTDLDQA antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 1984447;

  27. Immunogenicity and protective effect against oral colonization by Streptococcus mutans of synthetic peptides of a streptococcal surface protein antige...

    ID: 1370851

    Description: epitope description:EPTPPTRTPDQAEPNKPTP antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 1984447;

  28. Human pregnancy-associated malaria-specific B cells target polymorphic, conformational epitopes in VAR2CSA.

    ID: 1370857

    Description: epitope description:KNEKKCINSKSGQGDKIQGACKRKCEK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens antibo...

    Publication: 17176260;

  29. Immunogenicity and protective effect against oral colonization by Streptococcus mutans of synthetic peptides of a streptococcal surface protein antige...

    ID: 1370866

    Description: epitope description:RGQSATATYTNLQNSYYNG antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 1984447;

  30. Immunogenicity and protective effect against oral colonization by Streptococcus mutans of synthetic peptides of a streptococcal surface protein antige...

    ID: 1370876

    Description: epitope description:EPTPPTRTPDQAEPNKPTP antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 1984447;

  31. Mapping the intersubunit region of influenza virus hemagglutinin: comparative CD and FTIR spectroscopic studies on multiple antigenic peptides.

    ID: 1370986

    Description: epitope description:ATGLRNVPQIESRGLFGAIAGFIEG antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 7574664;

  32. Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

    ID: 1371009

    Description: epitope description:DNIGNANIGFGN antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

    Publication: 15346333;

  33. Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

    ID: 1371011

    Description: epitope description:NIGFGNRGDANI antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

    Publication: 15346333;

  34. Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

    ID: 1371020

    Description: epitope description:RGDANIGIGNIG antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

    Publication: 15346333;

  35. Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

    ID: 1371027

    Description: epitope description:GIGNIGDRNLGI antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

    Publication: 15346333;

  36. Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

    ID: 1371050

    Description: epitope description:LSFTLTGNPNRP antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

    Publication: 15346333;

  37. Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

    ID: 1371052

    Description: epitope description:LSFTLTGNPNRP antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

    Publication: 15346333;

  38. Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

    ID: 1371076

    Description: epitope description:NSNNKEYT antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 1314456;

  39. Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

    ID: 1371081

    Description: epitope description:ASDSVGQQIKVI antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 1314456;

  40. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371082

    Description: epitope description:CTGKFKIVKEIAETQHGTIVIRVQYEGDGSPC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  41. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371084

    Description: epitope description:GLFGKGGIVTCAMFTC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  42. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371086

    Description: epitope description:EPSLNEEQDKRFLCKHSMVDR antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  43. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371090

    Description: epitope description:TPHSGEEHAVGNDTGKHGKEIKITPQSSITE antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  44. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371095

    Description: epitope description:HQVFGAIYGAAFSGVS antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  45. Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

    ID: 1371096

    Description: epitope description:STEQNVPDPQVG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 1314456;

  46. Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

    ID: 1371104

    Description: epitope description:VDTPWVEKESALS antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 1314456;

  47. Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

    ID: 1371107

    Description: epitope description:QFPFNASDSVGQ antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 1314456;

  48. Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

    ID: 1371108

    Description: epitope description:ASDSVGQQIKVI antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 1314456;

  49. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371123

    Description: epitope description:CTGKFKIVKEIAETQHGTIVIRVQYEGDGSPC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  50. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371160

    Description: epitope description:GLFGKGGIVTCAMFTC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston