Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911007

    Description: epitope description:W101, F108 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN2-12, FL0232

    Publication: 22235356;

  2. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911011

    Description: epitope description:Q211, D215, P217 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DENV4-4

    Publication: 22235356;

  3. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911012

    Description: epitope description:Q211, D215, P217 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DENV4-4

    Publication: 22235356;

  4. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911013

    Description: epitope description:Q211, D215, P217 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DENV4-4

    Publication: 22235356;

  5. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911018

    Description: epitope description:K307, K310, L389 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:FL0251

    Publication: 22235356;

  6. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911024

    Description: epitope description:P217 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN3-3

    Publication: 22235356;

  7. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911033

    Description: epitope description:W101, L107, F108 antigen name:Genome polyprotein host organism:Mus musculus antibody name:FL0231

    Publication: 22235356;

  8. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911037

    Description: epitope description:W101, G106, L107, F108 antigen name:Genome polyprotein host organism:Mus musculus antibody name:4G2

    Publication: 22235356;

  9. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911040

    Description: epitope description:P217, T265 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN2-9

    Publication: 22235356;

  10. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911041

    Description: epitope description:P217, T265 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN2-9

    Publication: 22235356;

  11. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911042

    Description: epitope description:P217, T265 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN2-9

    Publication: 22235356;

  12. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911043

    Description: epitope description:P217 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN3-3

    Publication: 22235356;

  13. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911062

    Description: epitope description:W101, L107, F108 antigen name:Genome polyprotein host organism:Mus musculus antibody name:FL0231

    Publication: 22235356;

  14. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911069

    Description: epitope description:W101, L107 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22235356;

  15. Glycoproteins are species-specific markers and major IgE reactants in grass pollens.

    ID: 1911085

    Description: epitope description:beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcpNAc antigen name:Laccase host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21951299;

  16. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911093

    Description: epitope description:W101, L107, F108 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22235356;

  17. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911095

    Description: epitope description:W101, F108, V122, T293 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22235356;

  18. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911096

    Description: epitope description:W101, L107, F108 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22235356;

  19. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911107

    Description: epitope description:W101, F108, V122, T293 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22235356;

  20. B cells that produce immunoglobulin E mediate colitis in BALB/c mice.

    ID: 1911166

    Description: epitope description:4-(ethoxymethylene)-2-phenyloxazol-5-one host organism:Mus musculus BALB/c

    Publication: 21983080;

  21. Structural basis of enhanced binding of extended and helically constrained peptide epitopes of the broadly neutralizing HIV-1 antibody 4E10.

    ID: 1911177

    Description: epitope description:NWFDITNWLWYIK antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:4E10

    Publication: 17125793;

  22. Structural basis of enhanced binding of extended and helically constrained peptide epitopes of the broadly neutralizing HIV-1 antibody 4E10.

    ID: 1911178

    Description: epitope description:NWFDITNWLWYIK antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:4E10

    Publication: 17125793;

  23. DA-9601 suppresses 2, 4-dinitrochlorobenzene and dust mite extract-induced atopic dermatitis-like skin lesions.

    ID: 1911183

    Description: epitope description:2,6-dinitrophenol host organism:Mus musculus BALB/c

    Publication: 21511060;

  24. Epitope based recombinant BCG vaccine elicits specific Th1 polarized immune responses in BALB/c mice.

    ID: 1915615

    Description: epitope description:EGWWPTLIGLAMNDS antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85C host organism:Cavia porcellus Duncan-Hartley

    Publication: 22200502;

  25. Structure of an antibody in complex with its mucin domain linear epitope that is protective against Ebola virus.

    ID: 1917071

    Description: epitope description:GKLGLITNTIAGVAGLI antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c antibody name:14G7

    Publication: 22171276;

  26. Crystal structure of a non-neutralizing antibody to the HIV-1 gp41 membrane-proximal external region.

    ID: 1917082

    Description: epitope description:QQEKNEQELLELDKWASLWN + AMID(N20) antigen name:Envelope glycoprotein gp160 host organism:Mus musculus BALB/c antibody name:13H11

    Publication: 21076400;

  27. Crystal structure of a non-neutralizing antibody to the HIV-1 gp41 membrane-proximal external region.

    ID: 1917084

    Description: epitope description:QQEKNEQELLELDKWASLWN + AMID(N20) antigen name:Envelope glycoprotein gp160 host organism:Mus musculus BALB/c antibody name:13H11

    Publication: 21076400;

  28. Scorpion-toxin mimics of CD4 in complex with human immunodeficiency virus gp120 crystal structures, molecular mimicry, and neutralization breadth.

    ID: 1917096

    Description: epitope description:C118, V119, L121, V196, T198, Q199, A200, R406, R406, I407, K408, Q409, I410, M421, P424 antigen name:Envelope glycoprotein gp160 ...

    Publication: 15893666;

  29. Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

    ID: 1917098

    Description: epitope description:TTVESHGKIGATQAGRF antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21889960;

  30. Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

    ID: 1917103

    Description: epitope description:TLDVRMINIEASQLA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21889960;

  31. Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

    ID: 1917108

    Description: epitope description:TLDVRMINIEASQLA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21889960;

  32. Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

    ID: 1917110

    Description: epitope description:TLDVRMINIEASQLA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21889960;

  33. Antibody 2G12 recognizes di-mannose equivalently in domain- and nondomain-exchanged forms but only binds the HIV-1 glycan shield if domain exchanged.

    ID: 1917127

    Description: epitope description:alpha-D-Manp-(1->2)-alpha-D-Manp host organism:Homo sapiens antibody name:2G12 I19R

    Publication: 20702629;

  34. Antibody 2G12 recognizes di-mannose equivalently in domain- and nondomain-exchanged forms but only binds the HIV-1 glycan shield if domain exchanged.

    ID: 1917129

    Description: epitope description:alpha-D-Manp-(1->2)-alpha-D-Manp host organism:Homo sapiens antibody name:2G12 I19R

    Publication: 20702629;

  35. Structural basis of HIV-1 resistance to AZT by excision.

    ID: 1922176

    Description: epitope description:R199, Q222, K223, E224, P225, P226, F227, L228, W229, M230, R358 antigen name:Gag-Pol polyprotein host organism:Mus musculus BALB/...

    Publication: 20852643;

  36. Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.

    ID: 1922183

    Description: epitope description:PKLEPWKHP antigen name:Protein Tat host organism:Mus musculus antibody name:11H6H1

    Publication: 21035463;

  37. Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.

    ID: 1922186

    Description: epitope description:PKLEPWKHP antigen name:Protein Tat host organism:Mus musculus antibody name:11H6H1

    Publication: 21035463;

  38. Biotin sulfone tagged oligomannosides as immunogens for eliciting antibodies against specific mannan epitopes.

    ID: 1922208

    Description: epitope description:alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-alpha-D-Manp antigen name:mannan host organism:Mus musculus BALB/c

    Publication: 22326546;

  39. Biotin sulfone tagged oligomannosides as immunogens for eliciting antibodies against specific mannan epitopes.

    ID: 1922211

    Description: epitope description:beta-D-Man-(1->2)-beta-D-Man-(1->2)-beta-D-Man-(1->2)-alpha-D-Man antigen name:mannan host organism:Mus musculus BALB/c

    Publication: 22326546;

  40. Biotin sulfone tagged oligomannosides as immunogens for eliciting antibodies against specific mannan epitopes.

    ID: 1922213

    Description: epitope description:alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp antigen name:mannan host organism:Mus musculus BALB/c

    Publication: 22326546;

  41. Biotin sulfone tagged oligomannosides as immunogens for eliciting antibodies against specific mannan epitopes.

    ID: 1922215

    Description: epitope description:alpha-D-Manp-(1->2)-alpha-D-Manp antigen name:mannan host organism:Mus musculus BALB/c

    Publication: 22326546;

  42. Conserved structural elements in the V3 crown of HIV-1 gp120.

    ID: 1922222

    Description: epitope description:KRKRIHIGPGRAFYTTK antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:1006-15D

    Publication: 20622876;

  43. Conserved structural elements in the V3 crown of HIV-1 gp120.

    ID: 1922225

    Description: epitope description:TRKGIHIGPGRAFYATGQITGD antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:3074

    Publication: 20622876;

  44. Elicitation of structure-specific antibodies by epitope scaffolds.

    ID: 1922230

    Description: epitope description:LLELDKWA antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 20876137;

  45. Elicitation of structure-specific antibodies by epitope scaffolds.

    ID: 1922430

    Description: epitope description:LLELDKWA antigen name:Envelope glycoprotein gp160 host organism:Mus musculus BALB/c antibody name:11F10

    Publication: 20876137;

  46. Antigenic analysis monoclonal antibodies against different epitopes of σB protein of Muscovy duck reovirus.

    ID: 1922435

    Description: epitope description:TDGVCFPHHK antigen name:sigma-B protein host organism:Mus musculus BALB/c antibody name:2F7

    Publication: 22197425;

  47. Antigenic analysis monoclonal antibodies against different epitopes of σB protein of Muscovy duck reovirus.

    ID: 1922449

    Description: epitope description:YIRTPACWD antigen name:sigma-B protein host organism:Mus musculus BALB/c

    Publication: 22197425;

  48. Antigenic analysis monoclonal antibodies against different epitopes of σB protein of Muscovy duck reovirus.

    ID: 1922451

    Description: epitope description:YIRTPACWD antigen name:sigma-B protein host organism:Mus musculus BALB/c antibody name:1E5

    Publication: 22197425;

  49. Crystal structure of HIV-1 primary receptor CD4 in complex with a potent antiviral antibody.

    ID: 1927495

    Description: epitope description:V28, S56, K75, I101, E102, S104, D105, Q119, L121, S145, P147, G148, S149, S150, P151, S152, G165, G166, K167, L187, Q188, N189, Q...

    Publication: 21134642;

  50. Localization of linear B-cell epitopes on goose parvovirus structural protein.

    ID: 1927503

    Description: epitope description:SQSVSPDREPERKDNNRGFVLPGYKYLGPGNGLDKGP antigen name:VP1 host organism:Anser sp.

    Publication: 22209204;

  51. Localization of linear B-cell epitopes on goose parvovirus structural protein.

    ID: 1927504

    Description: epitope description:FAHSQDLDRLMNPLVDQYLWNF antigen name:VP1 host organism:Anser sp.

    Publication: 22209204;

  52. A highly conserved neutralizing epitope on group 2 influenza A viruses.

    ID: 1931363

    Description: epitope description:HA1: E341; HA2: E360, G361, I363, D364, R370, E375, T377, G378, Q379, A380, A381, L383, N491, E495 + GLYC(2:N499) antigen name:Hem...

    Publication: 21737702;

  53. A highly conserved neutralizing epitope on group 2 influenza A viruses.

    ID: 1931364

    Description: epitope description:HA1: E341; HA2: E360, G361, I363, D364, R370, E375, T377, G378, Q379, A380, A381, L383, N491, E495 + GLYC(2:N499) antigen name:Hem...

    Publication: 21737702;

  54. Specificity of human anti-NOR antibodies, a distinct species of ""natural"" anti-alpha-galactosyl antibodies.

    ID: 1931404

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp antigen name:Glycophorin-A host organism:Homo sapiens antibody name:Anti-Gal-alpha1-3-Gal antibodi...

    Publication: 12626386;

  55. Covalent binding of nitroso-sulfonamides to glutathione S-transferase in guinea pigs with delayed type hypersensitivity.

    ID: 1931122

    Description: epitope description:4-nitrosobenzenesulfonamide host organism:Oryctolagus cuniculus

    Publication: 22342371;

  56. Covalent binding of nitroso-sulfonamides to glutathione S-transferase in guinea pigs with delayed type hypersensitivity.

    ID: 1931126

    Description: epitope description:4-nitrosobenzenesulfonamide host organism:Cavia porcellus Hartley

    Publication: 22342371;

  57. Monoclonal antibodies against NS1 protein of Goose parvovirus.

    ID: 1931174

    Description: epitope description:EPVPERANEPEEPPKIWAPPTREELEELLRASPEL antigen name:REP host organism:Mus musculus BALB/c antibody name:3D9, 1B2, 3F12, 4C6

    Publication: 22509917;

  58. Monoclonal antibodies against NS1 protein of Goose parvovirus.

    ID: 1931176

    Description: epitope description:PQNSPEPKRSRNNYQVRCALHTYDNSMDVFE antigen name:REP host organism:Mus musculus BALB/c antibody name:3H8

    Publication: 22509917;

  59. Delivery of a DNA vaccine for Alzheimer's disease by electroporation versus gene gun generates potent and similar immune responses.

    ID: 1931177

    Description: epitope description:DAEFRHDSGYE antigen name:Amyloid beta A4 protein host organism:Mus musculus C57BL/6

    Publication: 22301697;

  60. Delivery of a DNA vaccine for Alzheimer's disease by electroporation versus gene gun generates potent and similar immune responses.

    ID: 1931178

    Description: epitope description:DAEFRHDSGYE antigen name:Amyloid beta A4 protein host organism:Mus musculus C57BL/6

    Publication: 22301697;

  61. Delivery of a DNA vaccine for Alzheimer's disease by electroporation versus gene gun generates potent and similar immune responses.

    ID: 1931181

    Description: epitope description:DAEFRHDSGYE antigen name:Amyloid beta A4 protein host organism:Mus musculus C57BL/6

    Publication: 22301697;

  62. Natural anti-A and anti-B of the ABO system: allo- and autoantibodies have different epitope specificity.

    ID: 1931207

    Description: epitope description:alpha-D-GalpNAc-(1->3)-D-GalpNAc antigen name:N-acetyl-alpha-D-galactosaminyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D...

    Publication: 21981750;

  63. A single conformational transglutaminase 2 epitope contributed by three domains is critical for celiac antibody binding and effects.

    ID: 1931320

    Description: epitope description:E153 antigen name:Protein-glutamine gamma-glutamyltransferase 2 host organism:Mus musculus antibody name:885

    Publication: 22198767;

  64. A highly conserved neutralizing epitope on group 2 influenza A viruses.

    ID: 1931351

    Description: epitope description:HA1: E341; HA2: E360, G361, I363, D364, R370, E375, T377, G378, Q379, A380, A381, L383, N491, E495 + GLYC(2:N499) antigen name:Hem...

    Publication: 21737702;

  65. A highly conserved neutralizing epitope on group 2 influenza A viruses.

    ID: 1931356

    Description: epitope description:HA1: E341; HA2: E360, G361, I363, D364, R370, E375, T377, G378, Q379, A380, A381, L383, N491, E495 + GLYC(2:N499) antigen name:Hem...

    Publication: 21737702;

  66. A highly conserved neutralizing epitope on group 2 influenza A viruses.

    ID: 1931357

    Description: epitope description:HA1: E341; HA2: E360, G361, I363, D364, R370, E375, T377, G378, Q379, A380, A381, L383, N491, E495 + GLYC(2:N499) antigen name:Hem...

    Publication: 21737702;

  67. A highly conserved neutralizing epitope on group 2 influenza A viruses.

    ID: 1931359

    Description: epitope description:HA1: E341; HA2: E360, G361, I363, D364, R370, E375, T377, G378, Q379, A380, A381, L383, N491, E495 + GLYC(2:N499) antigen name:Hem...

    Publication: 21737702;

  68. Specificity of human anti-NOR antibodies, a distinct species of ""natural"" anti-alpha-galactosyl antibodies.

    ID: 1931406

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp antigen name:Glycophorin-A host organism:Homo sapiens antibody name:Anti-Gal-alpha1-3-Gal antibodi...

    Publication: 12626386;

  69. Specificity of human anti-NOR antibodies, a distinct species of ""natural"" anti-alpha-galactosyl antibodies.

    ID: 1931409

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp antigen name:Glycophorin-A host organism:Homo sapiens antibody name:Anti-Gal-alpha1-3-Gal antibodi...

    Publication: 12626386;

  70. A highly conserved neutralizing epitope on group 2 influenza A viruses.

    ID: 1931420

    Description: epitope description:HA1: E341; HA2: E360, G361, I363, D364, R370, E375, T377, G378, Q379, A380, A381, L383, N491, E495 + GLYC(2:N499) antigen name:Hem...

    Publication: 21737702;

  71. Specificity of human anti-NOR antibodies, a distinct species of ""natural"" anti-alpha-galactosyl antibodies.

    ID: 1931434

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp antigen name:Glycophorin-A host organism:Homo sapiens antibody name:Anti-Gal-alpha1-3-Gal antibodi...

    Publication: 12626386;

  72. Specificity of human anti-NOR antibodies, a distinct species of ""natural"" anti-alpha-galactosyl antibodies.

    ID: 1931435

    Description: epitope description:D-galactose host organism:Homo sapiens antibody name:Anti-Gal-alpha1-3-Gal antibodies

    Publication: 12626386;

  73. Specificity of human anti-NOR antibodies, a distinct species of ""natural"" anti-alpha-galactosyl antibodies.

    ID: 1931442

    Description: epitope description:beta-melibiose host organism:Homo sapiens antibody name:Anti-NOR antibodies

    Publication: 12626386;

  74. Immunization with high epitope density of M2e derived from 2009 pandemic H1N1 elicits protective immunity in mice.

    ID: 1931465

    Description: epitope description:MSLLTEVETPTRSEWECRCSDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 22446634;

  75. Immunization with high epitope density of M2e derived from 2009 pandemic H1N1 elicits protective immunity in mice.

    ID: 1931469

    Description: epitope description:MSLLTEVETPTRSEWECRCSDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 22446634;

  76. Monoclonal antibodies to meningococcal factor H binding protein with overlapping epitopes and discordant functional activity.

    ID: 1931479

    Description: epitope description:R204 antigen name:Other Neisseria meningitidis protein host organism:Mus musculus CD1 antibody name:JAR1, 502

    Publication: 22461909;

  77. A strategy for mapping and neutralizing conformational immunogenic sites on protein therapeutics.

    ID: 1931493

    Description: epitope description:R162, G412, A413, G414, K415 antigen name:Carboxypeptidase G2 host organism:Homo sapiens

    Publication: 11921443;

  78. Immunochemical studies of human erythropoietin using site-specific anti-peptide antibodies. Identification of a functional domain.

    ID: 1931509

    Description: epitope description:TVPDTKVNFYAWKRMEVGQQ antigen name:Erythropoietin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2433274;

  79. Immunochemical studies of human erythropoietin using site-specific anti-peptide antibodies. Identification of a functional domain.

    ID: 1931515

    Description: epitope description:VSGLRSLTTLLRALGAQKEA antigen name:Erythropoietin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2433274;

  80. Anti-erythropoietin receptor monoclonal antibody: epitope mapping, quantification of the soluble receptor, and detection of the solubilized transmembr...

    ID: 1931527

    Description: epitope description:APSPSLPDPKFESKA antigen name:Erythropoietin receptor host organism:Mus musculus BALB/c antibody name:1G3

    Publication: 8695793;

  81. Identification of B- and T-cell epitopes from glycoprotein B of herpes simplex virus 2 and evaluation of their immunogenicity and protection efficacy.

    ID: 1931558

    Description: epitope description:REQDRKPRNATPAP antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c

    Publication: 22008818;

  82. Identification of B- and T-cell epitopes from glycoprotein B of herpes simplex virus 2 and evaluation of their immunogenicity and protection efficacy.

    ID: 1931561

    Description: epitope description:TTKARATSPTTRNL antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c

    Publication: 22008818;

  83. Molecular determinants for antibody binding on group 1 house dust mite allergens.

    ID: 1931584

    Description: epitope description:E111, D113, R115, Q116, R118, G253, R254, A278, Q279, Y283, D296, Y299, Y301 antigen name:Der p 1 host organism:Mus musculus BALB/...

    Publication: 22210776;

  84. Validation of a phage display and computational algorithm by mapping a conformational epitope of Bla g 2.

    ID: 1931587

    Description: epitope description:SMMKADFEEEPR host organism:Mus musculus antibody name:7C11

    Publication: 22123204;

  85. Anti-EPO and anti-NESP antibodies raised against synthetic peptides that reproduce the minimal amino acid sequence differences between EPO and NESP.

    ID: 1931589

    Description: epitope description:LVNSSQPWEPLQLHV antigen name:Erythropoietin host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-EPO (81-95)

    Publication: 17534608;

  86. Anti-EPO and anti-NESP antibodies raised against synthetic peptides that reproduce the minimal amino acid sequence differences between EPO and NESP.

    ID: 1931612

    Description: epitope description:QVNETLQLHVDKAVSGLRSC host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-NESP (86-104)

    Publication: 17534608;

  87. Carrier-bound nonallergenic Der p 2 peptides induce IgG antibodies blocking allergen-induced basophil activation in allergic patients.

    ID: 1931687

    Description: epitope description:EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWIVPKIAPKSEN antigen name:Der p 2 host organism:Homo sapiens

    Publication: 22339348;

  88. Carrier-bound nonallergenic Der p 2 peptides induce IgG antibodies blocking allergen-induced basophil activation in allergic patients.

    ID: 1931688

    Description: epitope description:APKSENVVVTVKVMGDNGVLACAIATHAKIRD antigen name:Der p 2 host organism:Homo sapiens

    Publication: 22339348;

  89. Carrier-bound nonallergenic Der p 2 peptides induce IgG antibodies blocking allergen-induced basophil activation in allergic patients.

    ID: 1931722

    Description: epitope description:EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWIVPKIAPKSEN antigen name:Der p 2 host organism:Oryctolagus cuniculus

    Publication: 22339348;

  90. Characterization of specific IgE response in vitro against protein and drug allergens using atopic and normal donors.

    ID: 1931737

    Description: epitope description:benzylpenicillin host organism:Homo sapiens

    Publication: 11906332;

  91. Natural anti-A and anti-B of the ABO system: allo- and autoantibodies have different epitope specificity.

    ID: 1931748

    Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-D-Galp antigen name:glycoprotein host organism:Homo sapiens

    Publication: 21981750;

  92. Structural and immunological characterization of the N-glycans from the major yellow jacket allergen Ves v 2: the N-glycan structures are needed for t...

    ID: 1934715

    Description: epitope description:NGGVPQEGNITIHLQK + GLYC(N79) antigen name:Ves v 2 host organism:Homo sapiens

    Publication: 19375166;

  93. Structural and immunological characterization of the N-glycans from the major yellow jacket allergen Ves v 2: the N-glycan structures are needed for t...

    ID: 1934716

    Description: epitope description:NGGVPQEGNITIHLQK + GLYC(N79) antigen name:Ves v 2 host organism:Homo sapiens

    Publication: 19375166;

  94. Structural and immunological characterization of the N-glycans from the major yellow jacket allergen Ves v 2: the N-glycan structures are needed for t...

    ID: 1934719

    Description: epitope description:IHKNFSIDLVR + GLYC(N127) antigen name:Ves v 2 host organism:Homo sapiens

    Publication: 19375166;

  95. Structural and immunological characterization of the N-glycans from the major yellow jacket allergen Ves v 2: the N-glycan structures are needed for t...

    ID: 1934726

    Description: epitope description:NEHPTWNK antigen name:Ves v 2 host organism:Homo sapiens

    Publication: 19375166;

  96. Recombinant monoclonal antibody recognizes a unique epitope on varicella-zoster virus immediate-early 63 protein.

    ID: 1934742

    Description: epitope description:EAPNVPLHRS antigen name:Transcriptional regulator ICP22 homolog host organism:Mus musculus BALB/c antibody name:rec-Ab 63P4

    Publication: 22438547;

  97. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935836

    Description: epitope description:VGPAENTTVEFP antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

    Publication: 22424314;

  98. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935845

    Description: epitope description:GSWVGNWYAYPT antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

    Publication: 22424314;

  99. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935854

    Description: epitope description:GMLGEVQFGGWN antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

    Publication: 22424314;

  100. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935856

    Description: epitope description:GMLGEVQFGGWN antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

    Publication: 22424314;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston