Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507487

    Description: epitope description:DQKPPSRQSQIESR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  2. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507489

    Description: epitope description:SPKRIGTGDR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  3. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507491

    Description: epitope description:YTHFAKAARFRR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  4. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507492

    Description: epitope description:EKSLTSLSE antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  5. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507497

    Description: epitope description:KLRERLKQR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  6. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507502

    Description: epitope description:GPKRIRTGDR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  7. Epitope analysis of soybean major allergen Gly m Bd 30K recognized by the mouse monoclonal antibody using overlapping peptides.

    ID: 1507504

    Description: epitope description:QGGCGRGWAFSATGAIEA antigen name:P34 probable thiol protease host organism:Mus musculus BALB/c antibody name:H6

    Publication: 8782415;

  8. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507511

    Description: epitope description:EKSLTSLSEVVLQNRRGLD antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  9. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507520

    Description: epitope description:TKLAQYQAELKRVQEANAA antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  10. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507526

    Description: epitope description:DLAAVKKANAANEADYQAK antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  11. A single peptide from the major outer membrane protein of Chlamydia trachomatis elicits T cell help for the production of antibodies to protective det...

    ID: 1507540

    Description: epitope description:GILWEGFGGDPCDPCTTWVDAISMRMGYYGDFVFDRVLKTDVNKEFQMGA antigen name:Major outer membrane porin, serovar D host organism:Mus musculus B...

    Publication: 1712817;

  12. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507541

    Description: epitope description:AYQKALAAYQAELKRVQEA antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  13. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507554

    Description: epitope description:AANNAANAALTAENTAIKK antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  14. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507558

    Description: epitope description:TNAANQAAYQKALAAYQAE antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  15. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507561

    Description: epitope description:IKQRNENAKATYEAALKQY antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  16. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507563

    Description: epitope description:AALTAENTAIKKRNADAKA antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  17. Isolation of an immunodominant IgE hapten from an epitope expression cDNA library. Dissection of the allergic effector reaction.

    ID: 1507564

    Description: epitope description:APYHFDLSGHAFGAM antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 7525573;

  18. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507565

    Description: epitope description:YDWLMF host organism:Mus musculus BALB/c antibody name:12A1

    Publication: 9034147;

  19. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507575

    Description: epitope description:LDWLWEWAEQ host organism:Mus musculus BALB/c antibody name:13F1

    Publication: 9034147;

  20. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507582

    Description: epitope description:AVWQWMWVEY host organism:Mus musculus BALB/c antibody name:12A1, 13F1, 21D2

    Publication: 9034147;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston