Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "
  1. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371162

    Description: epitope description:KHSMVDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  2. Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

    ID: 1371171

    Description: epitope description:STEQNVPDPQVG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1314456;
  3. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371175

    Description: epitope description:TPHSGEEHAVGNDTGKHGKEIKITPQSSITE antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  4. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371176

    Description: epitope description:SQEGAMHTALTGATEIQMSS antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  5. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371208

    Description: epitope description:GLFGKGGIVTCAMFT antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  6. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371215

    Description: epitope description:CKIPFEIMDLEKRHVLGRL antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  7. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371216

    Description: epitope description:CKKNMEGKVVLPENLEYTIV antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  8. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371217

    Description: epitope description:VHRQWFLDLPLP antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  9. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371218

    Description: epitope description:CKIPFEIMDLEKRHVLGRL antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  10. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371221

    Description: epitope description:TPHSGEEHAVGNDTGKHGKEIKITPQSSITE antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  11. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371223

    Description: epitope description:ITVNPIVTEKDSPVNIE antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  12. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371227

    Description: epitope description:CTGKFKIVKEIAETQHGTIVIRVQYEGDGSPC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  13. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371238

    Description: epitope description:HQVFGAIYGAAFSGVS antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;
  14. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371263

    Description: epitope description:CKIPFEIMDLEKRHVLGRL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2371772;
  15. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371270

    Description: epitope description:ITVNPIVTEKDSPVNIE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2371772;
  16. Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

    ID: 1371291

    Description: epitope description:TFNSNNKEY antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 1314456;
  17. Characterization and mapping of a B-cell immunogenic domain in hepatitis C virus E2 glycoprotein using a yeast peptide library.

    ID: 1371354

    Description: epitope description:GIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGAND antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7510436;
  18. T cell lines specific for an immunodominant epitope of human basic protein define an encephalitogenic determinant for experimental autoimmune encephal...

    ID: 1665153

    Description: epitope description:VHFFKNIVTPRTP antigen name:Myelin basic protein host organism:Rattus norvegicus LOU/M

    Publication: 1702803;
  19. T cell lines specific for an immunodominant epitope of human basic protein define an encephalitogenic determinant for experimental autoimmune encephal...

    ID: 1665154

    Description: epitope description:VHFFKNIVTPRTP antigen name:Myelin basic protein host organism:Rattus norvegicus LOU/M

    Publication: 1702803;
  20. T cell lines specific for an immunodominant epitope of human basic protein define an encephalitogenic determinant for experimental autoimmune encephal...

    ID: 1665155

    Description: epitope description:LSLSRFSWGAEGQR antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus norvegicus LOU/M

    Publication: 1702803;
  21. The use of hapten-polysaccharide conjugates for the induction of B-cell tolerance involving IgE responses. III. Specific tolerance induced by sulphona...

    ID: 1665163

    Description: epitope description:4-sulfanilamidobenzoic acid host organism:Cavia porcellus Strain (2 X 13)

    Publication: 91585;
  22. The use of hapten-polysaccharide conjugates for the induction of B-cell tolerance involving IgE responses. II. Specific tolerance induced by sulphonam...

    ID: 1665167

    Description: epitope description:4-sulfanilamidobenzoic acid host organism:Mus musculus CBA

    Publication: 313909;
  23. The use of hapten-polysaccharide conjugates for the induction of B-cell tolerance involving IgE responses. II. Specific tolerance induced by sulphonam...

    ID: 1665175

    Description: epitope description:4-sulfanilamidobenzoic acid host organism:Mus musculus CBA

    Publication: 313909;
  24. Immunochemical specificity of antisera raised against the synthetic encephalitogenic peptide SH624, residues 59-74 of the myelin basic protein.

    ID: 1665204

    Description: epitope description:TTHYGSLPQK antigen name:Myelin basic protein host organism:Gallus gallus

    Publication: 2437472;
  25. Immunochemical specificity of antisera raised against the synthetic encephalitogenic peptide SH624, residues 59-74 of the myelin basic protein.

    ID: 1665206

    Description: epitope description:TTHYGSLPQK antigen name:Myelin basic protein host organism:Gallus gallus

    Publication: 2437472;
  26. Immunochemical specificity of antisera raised against the synthetic encephalitogenic peptide SH624, residues 59-74 of the myelin basic protein.

    ID: 1665208

    Description: epitope description:TTHYGSLPQK antigen name:Myelin basic protein host organism:Gallus gallus

    Publication: 2437472;
  27. Immunochemical specificity of antisera raised against the synthetic encephalitogenic peptide SH624, residues 59-74 of the myelin basic protein.

    ID: 1665215

    Description: epitope description:HYGSLPQK antigen name:Myelin basic protein (UniProt:P02686) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2437472;
  28. Immunochemical specificity of antisera raised against the synthetic encephalitogenic peptide SH624, residues 59-74 of the myelin basic protein.

    ID: 1665231

    Description: epitope description:TTHYGSLPQK antigen name:Myelin basic protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2437472;
  29. Reductively aminated D-xylose-albumin conjugate as the immunogen for generation of IgG and IgE antibodies specific to D-xylitol, a haptenic allergen.

    ID: 1665272

    Description: epitope description:D-xylopyranose host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17979222;
  30. Chimeric papillomavirus-like particles.

    ID: 1665298

    Description: epitope description:DTPTLH antigen name:Protein E7 host organism:Mus musculus antibody name:anti-HPV16 E7 antibody (Triton)

    Publication: 9234950;
  31. Epitopes of peptide 43-88 of guinea pig myelin basic protein: localization with monoclonal antibodies.

    ID: 1665328

    Description: epitope description:SQDENPVVHF antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis antibody name:22.17

    Publication: 6187841;
  32. Fusion loop peptide of the West Nile virus envelope protein is essential for pathogenesis and is recognized by a therapeutic cross-reactive human mono...

    ID: 1665347

    Description: epitope description:W101, G104, G106, T484 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb11

    Publication: 19535627;
  33. Fusion loop peptide of the West Nile virus envelope protein is essential for pathogenesis and is recognized by a therapeutic cross-reactive human mono...

    ID: 1665354

    Description: epitope description:W101, G104, G106, T484 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb11

    Publication: 19535627;
  34. Myelin degeneration in multiple system atrophy detected by unique antibodies.

    ID: 1665408

    Description: epitope description:QDENPVV antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:QD-9

    Publication: 9736024;
  35. High-resolution autoreactive epitope mapping and structural modeling of the 65 kDa form of human glutamic acid decarboxylase.

    ID: 1665412

    Description: epitope description:E264 antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens antibody name:M10 (MICA-10)

    Publication: 10222205;
  36. High-resolution autoreactive epitope mapping and structural modeling of the 65 kDa form of human glutamic acid decarboxylase.

    ID: 1665691

    Description: epitope description:R536, Y540 antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens antibody name:M8 (MICA-8), M9 (MICA-9)

    Publication: 10222205;
  37. T cell lines specific for an immunodominant epitope of human basic protein define an encephalitogenic determinant for experimental autoimmune encephal...

    ID: 1665746

    Description: epitope description:VHFFKNIVTPRTP antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus norvegicus LOU/M

    Publication: 1702803;
  38. Hapten-specific respiratory hypersensitivity in guinea pigs.

    ID: 1665862

    Description: epitope description:4-tolyl isocyanate host organism:Cavia porcellus

    Publication: 211841;
  39. Immunological cross-reactivity to laboratory-produced HPV-11 virions of polysera raised against bacterially derived fusion proteins and synthetic pept...

    ID: 1665880

    Description: epitope description:DGDMVDTGFGAMNFADLQTNKSDVPIDI antigen name:Major capsid protein L1 (UniProt:P04012) host organism:Oryctolagus cuniculus antibody na...

    Publication: 2155503;
  40. Analysis of HPV-1 E4 gene expression using epitope-defined antibodies.

    ID: 1665955

    Description: epitope description:HLYADGLTD antigen name:Probable protein E4 host organism:Mus musculus BALB/c antibody name:mAb 4.37

    Publication: 2456213;
  41. Immunolocalization of proteolipid protein peptide 103-116 in myelin.

    ID: 1666399

    Description: epitope description:YKTTICGKGLSATV antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus

    Publication: 7511704;
  42. Vaccination with DNA encoding an immunodominant myelin basic protein peptide targeted to Fc of immunoglobulin G suppresses experimental autoimmune enc...

    ID: 1666453

    Description: epitope description:HYGSLPQKSQRSQDENPV antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis

    Publication: 9565646;
  43. Detection of cell-drug (hapten)-antibody complexes by the gel test.

    ID: 1666473

    Description: epitope description:(+)-catechin host organism:Homo sapiens

    Publication: 1502708;
  44. Identification of an encephalitogenic determinant of myelin proteolipid protein for the rabbit.

    ID: 1666554

    Description: epitope description:TGGQKGRGSRGQHQAHSLER antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1699974;
  45. Identification of an encephalitogenic determinant of myelin proteolipid protein for the rabbit.

    ID: 1666562

    Description: epitope description:MIAATYNFAVLKLMGRGTKF antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1699974;
  46. Identification of an encephalitogenic determinant of myelin proteolipid protein for the rabbit.

    ID: 1666569

    Description: epitope description:EALTGTEKLIETYFSKNYQDYE antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1699974;
  47. Identification of an encephalitogenic determinant of myelin proteolipid protein for the rabbit.

    ID: 1666576

    Description: epitope description:TGGQKGRGSRGQHQAHSLER antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1699974;
  48. Identification of an encephalitogenic determinant of myelin proteolipid protein for the rabbit.

    ID: 1666583

    Description: epitope description:MIAATYNFAVLKLMGRGTKF antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1699974;
  49. Penicillamine and penicillin can generate antigenic determinants on rat peritoneal cells in vitro.

    ID: 1666597

    Description: epitope description:D-penicillamine host organism:Oryctolagus cuniculus

    Publication: 1709917;
  50. Penicillamine and penicillin can generate antigenic determinants on rat peritoneal cells in vitro.

    ID: 1666602

    Description: epitope description:benzylpenicilloyl group host organism:Oryctolagus cuniculus

    Publication: 1709917;

Displaying 50 of 1,510,353 results for " "