Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Synthetic peptides corresponding to the F protein of RSV stimulate murine B and T cells but fail to confer protection.

    ID: 1435152

    Description: epitope description:ICLTRTDRGWFCD antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 1706591;

  2. Synthetic peptides corresponding to the F protein of RSV stimulate murine B and T cells but fail to confer protection.

    ID: 1435154

    Description: epitope description:ICLTRTDRGWFCD antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 1706591;

  3. Synthetic peptides corresponding to the F protein of RSV stimulate murine B and T cells but fail to confer protection.

    ID: 1435156

    Description: epitope description:YYVNKQEGKSLYVKG antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 1706591;

  4. Allergy to bovine beta-lactoglobulin: specificity of human IgE to tryptic peptides.

    ID: 1435163

    Description: epitope description:LIVTQTMK antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 10457108;

  5. Hypoallergenic variants of the major latex allergen Hev b 6.01 retaining human T lymphocyte reactivity.

    ID: 1435166

    Description: epitope description:EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD antigen name:Hev b 6 host organism:Homo sapiens antibody name:patient sera

    Publication: 15494541;

  6. Hypoallergenic variants of the major latex allergen Hev b 6.01 retaining human T lymphocyte reactivity.

    ID: 1435173

    Description: epitope description:EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD antigen name:Hev b 6 host organism:Mus musculus BALB/c antibody name:1A5.4

    Publication: 15494541;

  7. Hypoallergenic variants of the major latex allergen Hev b 6.01 retaining human T lymphocyte reactivity.

    ID: 1435178

    Description: epitope description:EQAGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD host organism:Homo sapiens antibody name:patient blood

    Publication: 15494541;

  8. Allergy to bovine beta-lactoglobulin: specificity of human IgE to tryptic peptides.

    ID: 1435405

    Description: epitope description:YLLFCMENSAEPEQSLVCQCLVR antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 10457108;

  9. Allergy to bovine beta-lactoglobulin: specificity of human IgE to tryptic peptides.

    ID: 1435406

    Description: epitope description:TPEVDDEALEK antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 10457108;

  10. Recognition of pertussis toxin by antibodies to synthetic peptides.

    ID: 1435441

    Description: epitope description:RDGQSVIGACASPYEGRYR antigen name:Pertussis toxin subunit 3 host organism:Mus musculus

    Publication: 2402246;

  11. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1463139

    Description: epitope description:TTDSGDGRQTIT antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8890224;

  12. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1463142

    Description: epitope description:QTITNPAYDEKR antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8890224;

  13. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1463152

    Description: epitope description:TDSSSDSQTITN antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8890224;

  14. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1463160

    Description: epitope description:DSGDGRQTITNP antigen name:Other Haemophilus influenzae protein host organism:Mus musculus BALB/c antibody name:30BD1

    Publication: 8890224;

  15. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463161

    Description: epitope description:DIDTASESSQDPQ antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 16944047;

  16. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1463170

    Description: epitope description:GDGRQTITNPAYDE antigen name:Other Haemophilus influenzae protein host organism:Mus musculus BALB/c antibody name:30BD1

    Publication: 8890224;

  17. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463176

    Description: epitope description:LSCKPWQESRKNK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 16944047;

  18. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463179

    Description: epitope description:QESRKNKAQTRTP antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 16944047;

  19. Mapping of functional and antigenic domains of the alpha 4 protein of herpes simplex virus 1.

    ID: 1463197

    Description: epitope description:PPPLSEAAPKPRAAA antigen name:Major viral transcription factor ICP4 host organism:Mus musculus antibody name:H942

    Publication: 2447289;

  20. Mapping of functional and antigenic domains of the alpha 4 protein of herpes simplex virus 1.

    ID: 1463199

    Description: epitope description:GGDDPDHDPDHPHDL antigen name:Major viral transcription factor ICP4 host organism:Mus musculus antibody name:H924

    Publication: 2447289;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston