Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

ID: 1935857

Description: epitope description:GMLGEVQFGGWN antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

ID: 1935858

Description: epitope description:QFGGWNGLTYFD antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

ID: 1935861

Description: epitope description:QFGGWNGLTYFD antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

ID: 1935870

Description: epitope description:PTDHDNVKQMWP antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

ID: 1935871

Description: epitope description:PTDHDNVKQMWP antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

ID: 1935875

Description: epitope description:VKQMWPAESRKP antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

ID: 1935880

Description: epitope description:AESRKPMSGCEV antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

ID: 1935881

Description: epitope description:AESRKPMSGCEV antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

ID: 1935885

Description: epitope description:MSGCEVFPCDNA antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

ID: 1935897

Description: epitope description:IQTKVTHEVDLW antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930212

Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930218

Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930226

Description: epitope description:DQLLSGSTPWSF host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930237

Description: epitope description:HENPKWHTTPVL host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930252

Description: epitope description:NHLHSQR host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930253

Description: epitope description:DTRITKR host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930263

Description: epitope description:HENPKQNPLTAR host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930264

Description: epitope description:HANPKQNNHTTS host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930274

Description: epitope description:HESPKPTVWQTK host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930275

Description: epitope description:WQTPSPQ host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930301

Description: epitope description:QKLSLPT host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930305

Description: epitope description:QRLSTQL host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930307

Description: epitope description:NQQLSRS host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930308

Description: epitope description:TQHLSRS host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930312

Description: epitope description:VPFLPQILSGSL host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930314

Description: epitope description:SAVLTDIHPVLP host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930316

Description: epitope description:PAKNPSA host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930337

Description: epitope description:LDLERDARVRAERNANEMSI antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930346

Description: epitope description:LDLERDARVRAERNANEMSI antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930354

Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930360

Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930363

Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930364

Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930368

Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930370

Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930375

Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930381

Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of alpha-helical vs non-helical epitopes of Taenia sol...

ID: 1930386

Description: epitope description:LDELSGTSSQTHDAIRRKDME antigen name:Paramyosin host organism:Oryctolagus cuniculus New Zealand White

Inclusion of a specific T cell epitope increases the protection conferred against foot-and-mouth disease virus in pigs by a linear peptide containing ...

ID: 1930401

Description: epitope description:YTASARGDLAHLTTTHARH antigen name:Polyprotein host organism:Sus scrofa Landrace X Large White

A STUDY OF THE CROSS-REACTIVITY OF ANTIPURIN-6-OYL SERUM WITH DEOXYRIBONUCLEIC ACID (DNA).

ID: 1930448

Description: epitope description:purin-6-oyl group host organism:Oryctolagus cuniculus antibody name:anti-Pur-BSA

A STUDY OF THE CROSS-REACTIVITY OF ANTIPURIN-6-OYL SERUM WITH DEOXYRIBONUCLEIC ACID (DNA).

ID: 1930449

Description: epitope description:purin-6-oyl group host organism:Oryctolagus cuniculus antibody name:anti-Pur-BSA

A STUDY OF THE CROSS-REACTIVITY OF ANTIPURIN-6-OYL SERUM WITH DEOXYRIBONUCLEIC ACID (DNA).

ID: 1930452

Description: epitope description:purin-6-oyl group host organism:Oryctolagus cuniculus antibody name:anti-Pur-BSA

A STUDY OF THE CROSS-REACTIVITY OF ANTIPURIN-6-OYL SERUM WITH DEOXYRIBONUCLEIC ACID (DNA).

ID: 1930453

Description: epitope description:purin-6-oyl group host organism:Oryctolagus cuniculus antibody name:anti-Pur-BSA

A STUDY OF THE CROSS-REACTIVITY OF ANTIPURIN-6-OYL SERUM WITH DEOXYRIBONUCLEIC ACID (DNA).

ID: 1930455

Description: epitope description:purin-6-oyl group host organism:Oryctolagus cuniculus antibody name:anti-Pur-BSA

A STUDY OF THE CROSS-REACTIVITY OF ANTIPURIN-6-OYL SERUM WITH DEOXYRIBONUCLEIC ACID (DNA).

ID: 1930512

Description: epitope description:purin-6-oyl group host organism:Oryctolagus cuniculus antibody name:anti-Pur-BSA

Synthetic peptides as functional mimics of a viral discontinuous antigenic site.

ID: 1930527

Description: epitope description:PSQNFGHMHKVVLPPPPPPPPPPCFLMFENVPY + OX(C24) host organism:Cavia porcellus

Synthetic peptides as functional mimics of a viral discontinuous antigenic site.

ID: 1930529

Description: epitope description:CPPPPTG + SCM(C1) host organism:Bos taurus antibody name:anti-D8

A STUDY OF THE CROSS-REACTIVITY OF ANTIPURIN-6-OYL SERUM WITH DEOXYRIBONUCLEIC ACID (DNA).

ID: 1930550

Description: epitope description:purine-6-caboxamide host organism:Oryctolagus cuniculus antibody name:anti-Pur-BSA

A STUDY OF THE CROSS-REACTIVITY OF ANTIPURIN-6-OYL SERUM WITH DEOXYRIBONUCLEIC ACID (DNA).

ID: 1930551

Description: epitope description:hypoxanthine host organism:Oryctolagus cuniculus antibody name:anti-Pur-BSA

A STUDY OF THE CROSS-REACTIVITY OF ANTIPURIN-6-OYL SERUM WITH DEOXYRIBONUCLEIC ACID (DNA).

ID: 1930552

Description: epitope description:6-methylpurine host organism:Oryctolagus cuniculus antibody name:anti-Pur-BSA

A STUDY OF THE CROSS-REACTIVITY OF ANTIPURIN-6-OYL SERUM WITH DEOXYRIBONUCLEIC ACID (DNA).

ID: 1930558

Description: epitope description:thymine host organism:Oryctolagus cuniculus antibody name:anti-Pur-BSA

Isolation and characterization of an anti-peptide monoclonal antibody to human erythropoietin.

ID: 1930565

Description: epitope description:APPRLINDSRVLERYLLEAKEAEKIT host organism:Oryctolagus cuniculus New Zealand White

Anti-erythropoietin receptor monoclonal antibody: epitope mapping, quantification of the soluble receptor, and detection of the solubilized transmembr...

ID: 1930571

Description: epitope description:APSPSLPDPKFESKA antigen name:Erythropoietin receptor host organism:Mus musculus BALB/c antibody name:1G3

Anti-erythropoietin receptor monoclonal antibody: epitope mapping, quantification of the soluble receptor, and detection of the solubilized transmembr...

ID: 1930573

Description: epitope description:APSPSLPDPKFESKA antigen name:Erythropoietin receptor host organism:Mus musculus BALB/c antibody name:1G3

Production, characterization and utility of a panel of monoclonal antibodies for the detection of toluene diisocyanate haptenated proteins.

ID: 1930599

Description: epitope description:toluene 2,4-diisocyanate host organism:Mus musculus BALB/c antibody name:60G2, 62G5, 76G7

Production, characterization and utility of a panel of monoclonal antibodies for the detection of toluene diisocyanate haptenated proteins.

ID: 1930601

Description: epitope description:toluene 2,4-diisocyanate host organism:Mus musculus BALB/c antibody name:62G5, 76G7

Characterization and specificity of the linear epitope of the enterovirus 71 VP2 protein.

ID: 1930626

Description: epitope description:EDSHP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:7C7

Evidence for the location of the receptor-binding site of human erythropoietin at the carboxyl-terminal domain.

ID: 1930628

Description: epitope description:SSQPWEPLQLHV antigen name:Erythropoietin host organism:Oryctolagus cuniculus

Evidence for the location of the receptor-binding site of human erythropoietin at the carboxyl-terminal domain.

ID: 1930629

Description: epitope description:SSQPWEPLQLHV antigen name:Erythropoietin host organism:Oryctolagus cuniculus antibody name:anti-P1

Evidence for the location of the receptor-binding site of human erythropoietin at the carboxyl-terminal domain.

ID: 1930643

Description: epitope description:SSQPWEPLQLHV antigen name:Erythropoietin host organism:Oryctolagus cuniculus antibody name:anti-P1

Evidence for the location of the receptor-binding site of human erythropoietin at the carboxyl-terminal domain.

ID: 1930644

Description: epitope description:KLKLYTGEACRTGDR antigen name:Erythropoietin host organism:Oryctolagus cuniculus antibody name:anti-P2

Evidence for the location of the receptor-binding site of human erythropoietin at the carboxyl-terminal domain.

ID: 1930645

Description: epitope description:KRMEVGQQAVEV antigen name:Erythropoietin host organism:Oryctolagus cuniculus antibody name:anti-P3

Evidence for the location of the receptor-binding site of human erythropoietin at the carboxyl-terminal domain.

ID: 1930650

Description: epitope description:KRMEVGQQAVEV antigen name:Erythropoietin host organism:Oryctolagus cuniculus antibody name:anti-P3

Evidence for the location of the receptor-binding site of human erythropoietin at the carboxyl-terminal domain.

ID: 1930652

Description: epitope description:RALRAQKEAISPPD antigen name:Erythropoietin host organism:Oryctolagus cuniculus antibody name:anti-P5

Discrepant effects of human interferon-gamma on clinical and immunological disease parameters in a novel marmoset model for multiple sclerosis.

ID: 1930674

Description: epitope description:GMEVGWYRPPFSRVVHLYRNGKD antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Callithrix jacchus

Characterization and specificity of the linear epitope of the enterovirus 71 VP2 protein.

ID: 1930691

Description: epitope description:ENSHPP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:7C7

Characterization and specificity of the linear epitope of the enterovirus 71 VP2 protein.

ID: 1930697

Description: epitope description:ENSHPP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:7C7

Characterization and specificity of the linear epitope of the enterovirus 71 VP2 protein.

ID: 1930700

Description: epitope description:ENSHPP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:7C7

A plant-derived human monoclonal antibody induces an anti-carbohydrate immune response in rabbits.

ID: 1930717

Description: epitope description:alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-Gl...

A plant-derived human monoclonal antibody induces an anti-carbohydrate immune response in rabbits.

ID: 1930721

Description: epitope description:beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta...

A plant-derived human monoclonal antibody induces an anti-carbohydrate immune response in rabbits.

ID: 1930725

Description: epitope description:beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->3)-[beta-D-GlcpNAc-(1->2)-alpha-D-Manp-(1->6)]-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta...

Identification of a surface epitope of human erythropoietin with anti-peptide antibodies.

ID: 1930743

Description: epitope description:DSRVLERY antigen name:Erythropoietin receptor host organism:Oryctolagus cuniculus New Zealand White

Minor interference of cross-reactive carbohydrates with the diagnosis of respiratory allergy in standard clinical conditions.

ID: 1930797

Description: epitope description:alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->6)-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-GlcpNAc antigen name:Ana...

Molecular determinants for antibody binding on group 1 house dust mite allergens.

ID: 1930805

Description: epitope description:R254, Y283, D296 antigen name:Der p 1 host organism:Homo sapiens

An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.

ID: 1930811

Description: epitope description:S138, S139, P141, N142, K171, G172, S173, S174, Y175, P176, K177, S179, K180, S181, V183, N211, E260, T262 antigen name:Hemaggluti...

An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.

ID: 1931108

Description: epitope description:S138, S139, P141, N142, K171, G172, S173, S174, Y175, P176, K177, S179, K180, S181, V183, N211, E260, T262 antigen name:Hemaggluti...

An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.

ID: 1931114

Description: epitope description:S138, S139, P141, N142, K171, G172, S173, S174, Y175, P176, K177, S179, K180, S181, V183, N211, E260, T262 antigen name:Hemaggluti...

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907855

Description: epitope description:MPFVNKQFNYKDPVNGVDI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907860

Description: epitope description:LKVIDTNCINVIQPDGSYR antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus ICR

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907865

Description: epitope description:GPSADIIQFECKSFGHEVL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907869

Description: epitope description:GHEVLNLTRNGYGSTQYIR antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus ICR

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907873

Description: epitope description:EESLEVDTNPLLGAGKFAT antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907886

Description: epitope description:MSGLEVSFEELRTFGGHDA antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907907

Description: epitope description:KFDKLYKMLTEIYTEDNFV antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907915

Description: epitope description:VPKVNYTIYDGFNLRNTNL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907920

Description: epitope description:RNTNLAANFNGQNTEINNM antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus ICR

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907924

Description: epitope description:EINNMNFTKLKNFTGLFEF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907926

Description: epitope description:EINNMNFTKLKNFTGLFEF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus ICR

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907930

Description: epitope description:ITSKTKSLDKGYNKALNDL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907934

Description: epitope description:WVIPERDTFTNPEEGDLNP antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

Regions of recognition by blocking antibodies on the light chain of botulinum neurotoxin A: antigenic structure of the entire toxin.

ID: 1907947

Description: epitope description:YSTDLGRMLLTSIVRGIPF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus ICR

Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

ID: 1908032

Description: epitope description:VTDVITIPTA antigen name:Genome polyprotein host organism:Mus musculus

Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

ID: 1908033

Description: epitope description:VTDVITIPTA antigen name:Genome polyprotein host organism:Mus musculus

Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

ID: 1908035

Description: epitope description:SLTVQTHGESTLA antigen name:Genome polyprotein host organism:Mus musculus

Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

ID: 1908041

Description: epitope description:TLDVRMINIEASQLA antigen name:Genome polyprotein host organism:Mus musculus

Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

ID: 1908051

Description: epitope description:TLDVRMINIEASQLA antigen name:Genome polyprotein host organism:Homo sapiens

Efficient production of chimeric human papillomavirus 16 L1 protein bearing the M2e influenza epitope in Nicotiana benthamiana plants.

ID: 1908200

Description: epitope description:SLLTEVETPTRNEWECKCIDSSD antigen name:Matrix protein 2 host organism:Mus musculus antibody name:14C2

Diagnostic epitope variability within Taenia solium 8 kDa antigen family: implications for cysticercosis immunodetection.

ID: 1908220

Description: epitope description:KKKMMKHLGEVRRFF antigen name:Excretion-secretion antigen m13 host organism:Homo sapiens

Diagnostic epitope variability within Taenia solium 8 kDa antigen family: implications for cysticercosis immunodetection.

ID: 1908224

Description: epitope description:IRKCLGEYLKGLENE antigen name:Cysticercosis 10kDa antigen host organism:Homo sapiens

Vaccination with M2e-based multiple antigenic peptides: characterization of the B cell response and protection efficacy in inbred and outbred mice.

ID: 1908226

Description: epitope description:SLLTEVETPIRNEWG antigen name:Matrix protein 2 host organism:Mus musculus BALB/c