Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Activation and hapten inhibition of mast cells sensitized with monoclonal IgE anti-penicillin antibodies: evidence for two-site recognition of the pen...

    ID: 1666606

    Description: epitope description:benzylpenicilloyl group host organism:Mus musculus C57BL/6 antibody name:BIE-13CE

    Publication: 7589115;

  2. Immunochemical analysis of sulfonamide drug allergy: identification of sulfamethoxazole-substituted human serum proteins.

    ID: 1666613

    Description: epitope description:penicillin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7798534;

  3. Immunological analysis of the amino terminal and the C8 isomer of human myelin basic protein.

    ID: 1666697

    Description: epitope description:ASQKRPSQR + ACET(1A) antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL antibody name:F23C6, F28C4 a...

    Publication: 7689598;

  4. Defective T helper cell epitope responsible for the failure of region 69-84 of the human myelin basic protein to induce experimental allergic encephal...

    ID: 1666704

    Description: epitope description:GSLPQKSQRSQDEN antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis

    Publication: 2479765;

  5. Comparison of the antibody response to bee venom phospholipase A2 induced by natural exposure in humans or by immunization in mice.

    ID: 1666719

    Description: epitope description:EHPVTGCGERTEGRCLHYTV antigen name:Api m 1 host organism:Mus musculus BALB/c antibody name:3F3, 1D12, 3H8, 1C11, 2B6, 2F5

    Publication: 9376132;

  6. Fusion loop peptide of the West Nile virus envelope protein is essential for pathogenesis and is recognized by a therapeutic cross-reactive human mono...

    ID: 1666731

    Description: epitope description:W101, G104, G106, T484 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb11

    Publication: 19535627;

  7. Fusion loop peptide of the West Nile virus envelope protein is essential for pathogenesis and is recognized by a therapeutic cross-reactive human mono...

    ID: 1666744

    Description: epitope description:W101, G104, G106, T484 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb11

    Publication: 19535627;

  8. Monoclonal and polyclonal antibody responses to the myelin basic protein epitope present in human urine.

    ID: 1666763

    Description: epitope description:TQDENP antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:F41B5 (7CB5)

    Publication: 7515900;

  9. Monoclonal and polyclonal antibody responses to the myelin basic protein epitope present in human urine.

    ID: 1666764

    Description: epitope description:PQDENPVVHF antigen name:Myelin basic protein host organism:Mus musculus BALB/c antibody name:F41B5 (7CB5), F41C11 (7CC11)

    Publication: 7515900;

  10. Monoclonal and polyclonal antibody responses to the myelin basic protein epitope present in human urine.

    ID: 1666835

    Description: epitope description:QKSHGRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:F41B5 (7CB5)

    Publication: 7515900;

  11. Monoclonal and polyclonal antibody responses to the myelin basic protein epitope present in human urine.

    ID: 1666839

    Description: epitope description:QKSHGRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:F41B5 (7CB5)

    Publication: 7515900;

  12. Phthalic anhydride allergy: development and characterization of optimized hapten-carrier conjugates for improved diagnosis.

    ID: 1666886

    Description: epitope description:phthalic anhydride host organism:Homo sapiens

    Publication: 12269934;

  13. Detection of human IgE to sulfamethoxazole by skin testing with sulfamethoxazoyl-poly-L-tyrosine.

    ID: 1666897

    Description: epitope description:sulfamethoxazole host organism:Homo sapiens

    Publication: 1955637;

  14. Detection of human IgE to sulfamethoxazole by skin testing with sulfamethoxazoyl-poly-L-tyrosine.

    ID: 1666906

    Description: epitope description:penicillin host organism:Homo sapiens

    Publication: 1955637;

  15. Detection of human IgE to sulfamethoxazole by skin testing with sulfamethoxazoyl-poly-L-tyrosine.

    ID: 1666909

    Description: epitope description:benzylpenicilloyl-benzylamine host organism:Homo sapiens

    Publication: 1955637;

  16. Studies on N1-DNCP-N6-lactobionoyl-1,6-hexanediamine--a distinctive monovalent anaphylactogen.

    ID: 1666951

    Description: epitope description:3,5-dinitrosalicylic acid host organism:Oryctolagus cuniculus

    Publication: 4077350;

  17. Basic aspects related to penicillin-allergy skin testing: on the variability of the hapten-paratope interaction.

    ID: 1667046

    Description: epitope description:carbenicilloyl group host organism:Cavia porcellus

    Publication: 7503403;

  18. B cells play a cooperative role via CD40L-CD40 interaction in T cell-mediated experimental autoimmune neuritis in Lewis rats.

    ID: 1667058

    Description: epitope description:SSKRGRQTPVLYAMLDH antigen name:Myelin protein P0 host organism:Rattus norvegicus Lewis

    Publication: 17188497;

  19. Allergy to penicillin unsuccessfully treated with a haptenic inhibitor (benzyl-penicilloyl-N2-formil-lysine; BPO-flys). A case report.

    ID: 1667080

    Description: epitope description:benzylpenicilloyl group host organism:Homo sapiens

    Publication: 709786;

  20. Equilibrium and nonequilibrium competitive inhibitions of antipeptide antibody binding by parent myelin basic protein and 18 related peptide sequences...

    ID: 1667216

    Description: epitope description:TTHYGSLPQKAQGHRPQDE antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis

    Publication: 6168926;

  21. Evaluation of antibody binding to diisocyanate protein conjugates in a general population.

    ID: 1667276

    Description: epitope description:hexamethylene diisocyanate host organism:Homo sapiens

    Publication: 17042142;

  22. The induction of respiratory allergy in guinea-pigs following intradermal injection of trimellitic anhydride: a comparison with the response to 2,4-di...

    ID: 1667280

    Description: epitope description:trimellitic anhydride host organism:Cavia porcellus Duncan-Hartley

    Publication: 2469142;

  23. The induction of respiratory allergy in guinea-pigs following intradermal injection of trimellitic anhydride: a comparison with the response to 2,4-di...

    ID: 1667287

    Description: epitope description:2,4-dinitrophenyl group host organism:Cavia porcellus Duncan-Hartley

    Publication: 2469142;

  24. Equilibrium and nonequilibrium competitive inhibitions of antipeptide antibody binding by parent myelin basic protein and 18 related peptide sequences...

    ID: 1667573

    Description: epitope description:TTHYGSLPQKAQGHRPQDE antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis

    Publication: 6168926;

  25. Equilibrium and nonequilibrium competitive inhibitions of antipeptide antibody binding by parent myelin basic protein and 18 related peptide sequences...

    ID: 1667574

    Description: epitope description:TTHYGSLPQKAQGHRPQDE antigen name:Myelin basic protein host organism:Oryctolagus cuniculus

    Publication: 6168926;

  26. Recognition of the immunodominant myelin basic protein peptide by autoantibodies and HLA-DR2-restricted T cell clones from multiple sclerosis patients...

    ID: 1667602

    Description: epitope description:TGGVYHFVKKHVHES antigen name:DNA polymerase catalytic subunit host organism:Homo sapiens

    Publication: 9276728;

  27. Recognition of the immunodominant myelin basic protein peptide by autoantibodies and HLA-DR2-restricted T cell clones from multiple sclerosis patients...

    ID: 1667633

    Description: epitope description:ELLHQRFFKNVESTP antigen name:AngR host organism:Homo sapiens

    Publication: 9276728;

  28. Recognition of the immunodominant myelin basic protein peptide by autoantibodies and HLA-DR2-restricted T cell clones from multiple sclerosis patients...

    ID: 1667636

    Description: epitope description:GIDFDKFFKNRIDTF antigen name:Other Staphylococcus aureus protein host organism:Homo sapiens

    Publication: 9276728;

  29. Recognition of the immunodominant myelin basic protein peptide by autoantibodies and HLA-DR2-restricted T cell clones from multiple sclerosis patients...

    ID: 1667637

    Description: epitope description:RNKIRQFFKNQDKEL antigen name:K00951 GTP pyrophosphokinase host organism:Homo sapiens

    Publication: 9276728;

  30. Gating the selectivity filter in ClC chloride channels.

    ID: 1667737

    Description: epitope description:A: K243, D246, P248, L249, N250, P380, Q381, Y382, H383; B: I231, H234, E235 antigen name:H(+)/Cl(-) exchange transporter ClcA hos...

    Publication: 12649487;

  31. Gating the selectivity filter in ClC chloride channels.

    ID: 1667738

    Description: epitope description:A: K243, D246, P248, L249, N250, P380, Q381, Y382, H383; B: I231, H234, E235 antigen name:H(+)/Cl(-) exchange transporter ClcA hos...

    Publication: 12649487;

  32. A survey of the prevalence of penicillin-specific IgG, IgM and IgE antibodies detected by ELISA and defined by hapten inhibition, in patients with sus...

    ID: 1667761

    Description: epitope description:benzylpenicilloyl group host organism:Homo sapiens

    Publication: 3358899;

  33. Induction and modification of anti-TNP reaginic and IgG antibody responses by reactive trinitrophenyl derivatives.

    ID: 1667813

    Description: epitope description:2,4,6-trinitrophenyl group host organism:Mus musculus CBA

    Publication: 361549;

  34. Immunoglobulin E antibodies to rocuronium: a new diagnostic tool.

    ID: 1668079

    Description: epitope description:vecuronium host organism:Homo sapiens

    Publication: 17667569;

  35. Monoclonal antibodies to human myelin basic protein.

    ID: 1668090

    Description: epitope description:DHARHGFLPRHRDTGIL antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL antibody name:Mab 1

    Publication: 2415682;

  36. Monoclonal antibodies to human myelin basic protein.

    ID: 1668093

    Description: epitope description:DHARHGFLPRHRDTGIL antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL antibody name:Mab 1

    Publication: 2415682;

  37. Monoclonal antibodies to human myelin basic protein.

    ID: 1668105

    Description: epitope description:GSLPQKSHGRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL antibody name:Mab 3

    Publication: 2415682;

  38. Monoclonal antibodies to human myelin basic protein.

    ID: 1668134

    Description: epitope description:FKNIVTPRTPPPSQGKGRGLSLSRFSW antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL antibody name...

    Publication: 2415682;

  39. Monoclonal antibodies to human myelin basic protein.

    ID: 1668135

    Description: epitope description:AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL ...

    Publication: 2415682;

  40. Generation of an antibody specific to erythritol, a non-immunogenic food additive.

    ID: 1668217

    Description: epitope description:erythritol host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16901854;

  41. Generation of an antibody specific to erythritol, a non-immunogenic food additive.

    ID: 1668234

    Description: epitope description:erythritol host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16901854;

  42. Generation of an antibody specific to erythritol, a non-immunogenic food additive.

    ID: 1668235

    Description: epitope description:erythritol host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16901854;

  43. Generation of an antibody specific to erythritol, a non-immunogenic food additive.

    ID: 1668239

    Description: epitope description:erythritol host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16901854;

  44. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674222

    Description: epitope description:aztreonam host organism:Mus musculus BALB/c antibody name:Az-3

    Publication: 1384868;

  45. Antigenicity of beta-lactam antibiotic preparations: production of IgE antibodies to beta-lactam antibiotic and their cross-reaction within the antibi...

    ID: 1674251

    Description: epitope description:benzylpenicillin host organism:Mus musculus BALB/c

    Publication: 6176550;

  46. Antigenicity of beta-lactam antibiotic preparations: production of IgE antibodies to beta-lactam antibiotic and their cross-reaction within the antibi...

    ID: 1674257

    Description: epitope description:cefalotin host organism:Mus musculus BALB/c

    Publication: 6176550;

  47. Antigenicity of beta-lactam antibiotic preparations: production of IgE antibodies to beta-lactam antibiotic and their cross-reaction within the antibi...

    ID: 1674258

    Description: epitope description:cefalotin host organism:Mus musculus BALB/c

    Publication: 6176550;

  48. Antigenicity of beta-lactam antibiotic preparations: production of IgE antibodies to beta-lactam antibiotic and their cross-reaction within the antibi...

    ID: 1674271

    Description: epitope description:cefmetazole sodium host organism:Mus musculus BALB/c

    Publication: 6176550;

  49. Antigenicity of beta-lactam antibiotic preparations: production of IgE antibodies to beta-lactam antibiotic and their cross-reaction within the antibi...

    ID: 1674274

    Description: epitope description:carbenicillin host organism:Mus musculus BALB/c

    Publication: 6176550;

  50. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674284

    Description: epitope description:aztreonam host organism:Mus musculus BALB/c antibody name:Az-3

    Publication: 1384868;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston