Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674285

    Description: epitope description:aztreonam host organism:Mus musculus BALB/c antibody name:Az-3

    Publication: 1384868;

  2. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674287

    Description: epitope description:aztreonam host organism:Mus musculus BALB/c

    Publication: 1384868;

  3. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674289

    Description: epitope description:aztreonam host organism:Mus musculus BALB/c antibody name:Az-3

    Publication: 1384868;

  4. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674291

    Description: epitope description:aztreonam host organism:Mus musculus BALB/c antibody name:Az-3

    Publication: 1384868;

  5. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674299

    Description: epitope description:cefuzonam host organism:Mus musculus BALB/c antibody name:Az-3

    Publication: 1384868;

  6. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674300

    Description: epitope description:cefotaxime host organism:Mus musculus BALB/c antibody name:Az-3

    Publication: 1384868;

  7. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674301

    Description: epitope description:ceftizoxime host organism:Mus musculus BALB/c antibody name:Az-3

    Publication: 1384868;

  8. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674304

    Description: epitope description:ceftazidime host organism:Mus musculus BALB/c antibody name:Az-3

    Publication: 1384868;

  9. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674319

    Description: epitope description:benzylpenicillin host organism:Mus musculus BALB/c antibody name:Az-1, Az-2

    Publication: 1384868;

  10. Epitope mapping of beta-lactam antibiotics with the use of monoclonal antibodies.

    ID: 1674362

    Description: epitope description:benzylpenicillin host organism:Mus musculus BALB/c antibody name:AO.25.2

    Publication: 7716788;

  11. Epitope mapping of beta-lactam antibiotics with the use of monoclonal antibodies.

    ID: 1674378

    Description: epitope description:D-4-hydroxyphenylglycine host organism:Mus musculus BALB/c antibody name:AO.6.2

    Publication: 7716788;

  12. Epitope mapping of beta-lactam antibiotics with the use of monoclonal antibodies.

    ID: 1674380

    Description: epitope description:D-4-hydroxyphenylglycine host organism:Mus musculus BALB/c antibody name:AO.2.2, AO.3.2, AO7.2, AO.9.2, AO.12.2, AO.14.1, AO.18.2,...

    Publication: 7716788;

  13. Epitope mapping of beta-lactam antibiotics with the use of monoclonal antibodies.

    ID: 1674386

    Description: epitope description:(S)-2,5,5-trimethylthiazolidine-4-carboxylic acid host organism:Mus musculus BALB/c antibody name:AO.18.2, AO.19.1, AO.21.1, AO.24...

    Publication: 7716788;

  14. Human transaldolase and cross-reactive viral epitopes identified by autoantibodies of multiple sclerosis patients.

    ID: 1662536

    Description: epitope description:GIHCNMTLLFSFAQA antigen name:Transaldolase host organism:Oryctolagus cuniculus New Zealand White antibody name:Ab 12484

    Publication: 10491006;

  15. Human transaldolase and cross-reactive viral epitopes identified by autoantibodies of multiple sclerosis patients.

    ID: 1662537

    Description: epitope description:SFAQAVACAEAGVTL antigen name:Transaldolase host organism:Homo sapiens

    Publication: 10491006;

  16. Human transaldolase and cross-reactive viral epitopes identified by autoantibodies of multiple sclerosis patients.

    ID: 1662542

    Description: epitope description:GRILDWHVANTDKKS antigen name:Transaldolase host organism:Oryctolagus cuniculus New Zealand White antibody name:Ab 12484

    Publication: 10491006;

  17. Human transaldolase and cross-reactive viral epitopes identified by autoantibodies of multiple sclerosis patients.

    ID: 1662552

    Description: epitope description:TGEIKALAGCDFLTI antigen name:Transaldolase host organism:Homo sapiens

    Publication: 10491006;

  18. Human transaldolase and cross-reactive viral epitopes identified by autoantibodies of multiple sclerosis patients.

    ID: 1662562

    Description: epitope description:EKSFRWLHNEDQMAV antigen name:Transaldolase host organism:Homo sapiens

    Publication: 10491006;

  19. Human transaldolase and cross-reactive viral epitopes identified by autoantibodies of multiple sclerosis patients.

    ID: 1662565

    Description: epitope description:GIRKFAADAVKLERM antigen name:Transaldolase host organism:Homo sapiens

    Publication: 10491006;

  20. Human transaldolase and cross-reactive viral epitopes identified by autoantibodies of multiple sclerosis patients.

    ID: 1662571

    Description: epitope description:FIVLSIAYPTLSEIK antigen name:Fusion glycoprotein F0 host organism:Homo sapiens

    Publication: 10491006;

  21. Human transaldolase and cross-reactive viral epitopes identified by autoantibodies of multiple sclerosis patients.

    ID: 1662575

    Description: epitope description:NPVMERFAAHAGDLV antigen name:Major capsid protein host organism:Homo sapiens

    Publication: 10491006;

  22. Penicillin immunogenicity in the presence of different pharmaceutical adjuvants.

    ID: 1662600

    Description: epitope description:D-penicillamine host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 50298;

  23. Epitope specificity of autoreactive T and B cells associated with experimental autoimmune encephalomyelitis and optic neuritis induced by oligodendroc...

    ID: 1662727

    Description: epitope description:DELGSKGLWADCVMATGLYHCK antigen name:Claudin-11 host organism:Mus musculus SJL

    Publication: 17082656;

  24. Epitope specificity of autoreactive T and B cells associated with experimental autoimmune encephalomyelitis and optic neuritis induced by oligodendroc...

    ID: 1662739

    Description: epitope description:SGSSSPTHAKSAHV antigen name:Claudin-11 host organism:Mus musculus SJL

    Publication: 17082656;

  25. Induction and modification of anti-TNP reaginic and IgG antibody responses by reactive trinitrophenyl derivatives.

    ID: 1662778

    Description: epitope description:2,4,6-trinitrophenyl group host organism:Mus musculus CBA

    Publication: 361549;

  26. Polyclonal antibodies to the encephalitogenic neighborhoods of myelin basic protein: singular affinity populations neutralized by specific synthetic p...

    ID: 1662863

    Description: epitope description:YGSLPQKAQGHRPQDEN antigen name:Myelin basic protein host organism:Oryctolagus cuniculus antibody name:rabbit anti-S82

    Publication: 2430996;

  27. Polyclonal antibodies to the encephalitogenic neighborhoods of myelin basic protein: singular affinity populations neutralized by specific synthetic p...

    ID: 1662870

    Description: epitope description:TTHYGSLPQK antigen name:Myelin basic protein host organism:Oryctolagus cuniculus antibody name:rabbit anti-S24

    Publication: 2430996;

  28. Unmasking of an unusual myelin basic protein epitope during the process of myelin degeneration in humans: a potential mechanism for the generation of ...

    ID: 1662922

    Description: epitope description:ARTAHYGSLPQKSHG antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:Clone 26

    Publication: 9094982;

  29. Unmasking of an unusual myelin basic protein epitope during the process of myelin degeneration in humans: a potential mechanism for the generation of ...

    ID: 1662933

    Description: epitope description:KSHGRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:Clone 22

    Publication: 9094982;

  30. Involvement of carbohydrate epitopes in the IgE response of celery-allergic patients.

    ID: 1662993

    Description: epitope description:alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->6)-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-GlcpNAc host organism:Ho...

    Publication: 10529586;

  31. Intravenous synthetic peptide MBP8298 delayed disease progression in an HLA Class II-defined cohort of patients with progressive multiple sclerosis: r...

    ID: 1663037

    Description: epitope description:DENPVVHFFKNIVTPRT antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 16879301;

  32. Use of recombinant fusion proteins and monoclonal antibodies to define linear and discontinuous antigenic sites on the dengue virus envelope glycoprot...

    ID: 1663051

    Description: epitope description:CIEAKLTNTTTESRCPTQGEPSLNEEQDKRFLCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCKKNMEGKVVLPENL antigen name:Genome polyprotein host organism:Mus mus...

    Publication: 1372140;

  33. A monoclonal antibody specific for a carbohydrate epitope recognizes an IgE-binding determinant shared by taxonomically unrelated allergenic pollens.

    ID: 1663156

    Description: epitope description:alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-Gl...

    Publication: 11260159;

  34. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663358

    Description: epitope description:TPAAPAGAAP antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  35. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663364

    Description: epitope description:VAAAGGVPAA antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  36. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663366

    Description: epitope description:NKYKTFVATF antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  37. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663370

    Description: epitope description:ALSTEPKGAA antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  38. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663374

    Description: epitope description:KLDAAYKLAY antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  39. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663384

    Description: epitope description:EVKATPAGEL antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  40. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663390

    Description: epitope description:PANDKFTVFE antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  41. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663398

    Description: epitope description:SYAATVATAP antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  42. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663399

    Description: epitope description:VATAPAVKYT antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  43. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663405

    Description: epitope description:KPAAAATGTA antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  44. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663407

    Description: epitope description:TAAVGAATGA antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  45. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663434

    Description: epitope description:EQKMIEKINV antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  46. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663440

    Description: epitope description:FVATFGAASN antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  47. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663445

    Description: epitope description:VDSSKAALTS antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  48. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663454

    Description: epitope description:EALRIIAGTL antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  49. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663456

    Description: epitope description:EVHGVKPAAE antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;

  50. Mapping of antibody binding epitopes of a recombinant Poa p IX allergen.

    ID: 1663462

    Description: epitope description:KVAATAANAA antigen name:Poa p 5 host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 1383697;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston