Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936227

    Description: epitope description:EPKLLAFSAPSPGDTVTAVKRSS antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  2. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936230

    Description: epitope description:LLVAMIPEYLSTAQQDFLGSWRDKTTDSTPGTWVWNTYEAFPPGFPP antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  3. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936232

    Description: epitope description:SGDTPLNIFSTLHRKLDNSVRDY antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  4. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936235

    Description: epitope description:VNARPLTQLKGADDEP antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  5. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936238

    Description: epitope description:SGDTLLAPFYMPNHKLDKNTRDY antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  6. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936240

    Description: epitope description:IPTSFCGYGDYLRKPESFGKA antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  7. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936242

    Description: epitope description:LLVVMVPEYVATSQTDFRGSWQDKDTDNLPGAWMWQTYDALPSTLPP antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  8. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935900

    Description: epitope description:HEVDLWTTLGAG antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

    Publication: 22424314;

  9. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935902

    Description: epitope description:TTLGAGSTGLTF antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

    Publication: 22424314;

  10. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935903

    Description: epitope description:TTLGAGSTGLTF antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

    Publication: 22424314;

  11. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935911

    Description: epitope description:AKQMWPAESRKP host organism:Homo sapiens

    Publication: 22424314;

  12. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935922

    Description: epitope description:VKQMWPAASRKP host organism:Homo sapiens

    Publication: 22424314;

  13. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935924

    Description: epitope description:VKQMWPAEARKP host organism:Homo sapiens

    Publication: 22424314;

  14. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935926

    Description: epitope description:VKQMWPAESAKP host organism:Homo sapiens

    Publication: 22424314;

  15. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935928

    Description: epitope description:VKQMWPAESRAP host organism:Homo sapiens

    Publication: 22424314;

  16. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935931

    Description: epitope description:VKQMWPAESRKA host organism:Homo sapiens

    Publication: 22424314;

  17. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935936

    Description: epitope description:MWAAESRKPMSG host organism:Homo sapiens

    Publication: 22424314;

  18. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935939

    Description: epitope description:MWPAASRKPMSG host organism:Homo sapiens

    Publication: 22424314;

  19. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935941

    Description: epitope description:MWPAEARKPMSG host organism:Homo sapiens

    Publication: 22424314;

  20. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935947

    Description: epitope description:MWPAESRKAMSG host organism:Homo sapiens

    Publication: 22424314;

  21. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935948

    Description: epitope description:MWPAESRKPASG host organism:Homo sapiens

    Publication: 22424314;

  22. Functional epitope core motif of the Anaplasma marginale major surface protein 1a and its incorporation onto bioelectrodes for antibody detection.

    ID: 1935958

    Description: epitope description:SEASTSSQLGA antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus

    Publication: 22427942;

  23. Minor interference of cross-reactive carbohydrates with the diagnosis of respiratory allergy in standard clinical conditions.

    ID: 1935969

    Description: epitope description:alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->6)-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-GlcpNAc antigen name:Ana...

    Publication: 21986086;

  24. Characterization of periplasmic protein BP26 epitopes of Brucella melitensis reacting with murine monoclonal and sheep antibodies.

    ID: 1935982

    Description: epitope description:NIQPIYVYPDDKNNLK antigen name:26 kDa periplasmic immunogenic protein host organism:Mus musculus BALB/c antibody name:2H9, 5F12

    Publication: 22457830;

  25. Identification of critical amino acids in an immunodominant IgE epitope of Pen c 13, a major allergen from Penicillium citrinum.

    ID: 1936003

    Description: epitope description:TYDSTAGEGVVFY antigen name:Penicillium citrinum protein host organism:Homo sapiens

    Publication: 22506037;

  26. Identification of critical amino acids in an immunodominant IgE epitope of Pen c 13, a major allergen from Penicillium citrinum.

    ID: 1936033

    Description: epitope description:VCTIAASTSTDGSASFTNFGSVVD antigen name:Penicillium citrinum protein host organism:Homo sapiens

    Publication: 22506037;

  27. Identification of critical amino acids in an immunodominant IgE epitope of Pen c 13, a major allergen from Penicillium citrinum.

    ID: 1936042

    Description: epitope description:IVQLATSSISR antigen name:Penicillium citrinum protein host organism:Homo sapiens

    Publication: 22506037;

  28. Lytic anti-alpha-galactosyl antibodies from patients with chronic Chagas' disease recognize novel O-linked oligosaccharides on mucin-like glycosyl-pho...

    ID: 1811760

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group antigen name:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-b...

    Publication: 7818483;

  29. Experimental therapy of African trypanosomiasis with a nanobody-conjugated human trypanolytic factor.

    ID: 1811764

    Description: epitope description:alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1...

    Publication: 16604085;

  30. Further studies on the chemical basis for serological specificity of Group A streptococcal carbohydrate.

    ID: 1811770

    Description: epitope description:N-acetyl-D-glucosamine antigen name:polysaccharide host organism:Oryctolagus cuniculus

    Publication: 13575668;

  31. Evaluation of progesterone-ovalbumin conjugates with different length linkers in enzyme-linked immunosorbant assay and surface plasmon resonance-based...

    ID: 1811773

    Description: epitope description:2,5-dioxo-1-pyrrolidinyl 6-(6-{3-[(progesterone-4-yl)thiopropionyl]aminohexanoyl}amino)hexanoate host organism:Rattus norvegicus

    Publication: 11996928;

  32. Evaluation of progesterone-ovalbumin conjugates with different length linkers in enzyme-linked immunosorbant assay and surface plasmon resonance-based...

    ID: 1811774

    Description: epitope description:2,5-dioxo-1-pyrrolidinyl 6-(6-{3-[(progesterone-4-yl)thiopropionyl]aminohexanoyl}amino)hexanoate host organism:Rattus norvegicus

    Publication: 11996928;

  33. Evaluation of progesterone-ovalbumin conjugates with different length linkers in enzyme-linked immunosorbant assay and surface plasmon resonance-based...

    ID: 1811775

    Description: epitope description:2,5-dioxo-1-pyrrolidinyl 6-(6-{3-[(progesterone-4-yl)thiopropionyl]aminohexanoyl}amino)hexanoate host organism:Rattus norvegicus

    Publication: 11996928;

  34. Three-dimensional structure of an anti-steroid Fab' and progesterone-Fab' complex.

    ID: 1811779

    Description: epitope description:corticosterone host organism:Mus musculus BALB/c antibody name:DB3

    Publication: 8496956;

  35. Ig knock-in mice producing anti-carbohydrate antibodies: breakthrough of B cells producing low affinity anti-self antibodies.

    ID: 1811808

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus C57BL/6 GalNAc Transferase null

    Publication: 18322191;

  36. Ganglioside complexes containing GQ1b as targets in Miller Fisher and Guillain-Barre syndromes.

    ID: 1811816

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 18339728;

  37. Ganglioside complexes containing GQ1b as targets in Miller Fisher and Guillain-Barre syndromes.

    ID: 1811817

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 18339728;

  38. Alpha-galactosyl antibody redistributes alpha-galactosyl at the surface of pig blood and endothelial cells.

    ID: 1811822

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Papio anubis

    Publication: 10544440;

  39. Autoantibodies against N-homocysteinylated proteins in humans: implications for atherosclerosis.

    ID: 1811848

    Description: epitope description:N(6)-L-homocysteinyl-L-lysine host organism:Homo sapiens

    Publication: 15131313;

  40. Detection of beta-amyloid peptide (1-16) and amyloid precursor protein (APP770) using spectroscopic ellipsometry and QCM techniques: a step forward to...

    ID: 1811867

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:DE2

    Publication: 20692146;

  41. X-ray structure of a voltage-dependent K+ channel.

    ID: 1811877

    Description: epitope description:Y67, L68, L71, Y72, E120, A124, G125, L126, G127, L128, F129, R130, V132, R136 antigen name:Voltage-gated potassium channel host o...

    Publication: 12721618;

  42. Potential role of molecular mimicry between Helicobacter pylori lipopolysaccharide and host Lewis blood group antigens in autoimmunity.

    ID: 1811885

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc antigen name:Other Homo sapiens (human) protein host o...

    Publication: 8675304;

  43. Potential role of molecular mimicry between Helicobacter pylori lipopolysaccharide and host Lewis blood group antigens in autoimmunity.

    ID: 1811890

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc antigen name:Other Homo sapiens (human) protein host o...

    Publication: 8675304;

  44. Structure of lactococcal phage p2 baseplate and its mechanism of activation.

    ID: 1811893

    Description: epitope description:H: Q198, K199, G200, W201, N202, W207, V217, S219, H232, D234, N236, P237, N238, S240, T242, W244; I: A225, R256 antigen name:Lact...

    Publication: 20351260;

  45. Campylobacter jejuni lipopolysaccharides in Guillain-Barré syndrome: molecular mimicry and host susceptibility.

    ID: 1811912

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 9710005;

  46. Further studies on the chemical basis for serological specificity of Group A streptococcal carbohydrate.

    ID: 1811916

    Description: epitope description:phenyl N-acetyl-beta-D-glucosaminide antigen name:polysaccharide host organism:Oryctolagus cuniculus

    Publication: 13575668;

  47. Carrier-specificity of a phosphorylcholine-binding antibody requires the presence of the constant domains and is not dependent on the unique VH49 glyc...

    ID: 1811934

    Description: epitope description:phosphocholine host organism:Mus musculus BALB/c antibody name:Mab2 Fab

    Publication: 17331532;

  48. Monoclonal antibodies against an arabinogalactan-protein from pressed juice of Echinacea purpurea.

    ID: 1811941

    Description: epitope description:alpha-L-Araf-(1->2)-[alpha-L-Araf-(1->5)-alpha-L-Araf-(1->2)-[beta-D-Galp-(1->6)]-beta-D-Galp-(1->6)-beta-D-Galp-(1->6)-beta-D-Gal...

    Publication: 15386194;

  49. Monoclonal antibodies against an arabinogalactan-protein from pressed juice of Echinacea purpurea.

    ID: 1811945

    Description: epitope description:alpha-L-Araf-(1->2)-[alpha-L-Araf-(1->5)-alpha-L-Araf-(1->2)-[beta-D-Galp-(1->6)]-beta-D-Galp-(1->6)-beta-D-Galp-(1->6)-beta-D-Gal...

    Publication: 15386194;

  50. Hepatitis C virus with a naturally occurring single amino-acid substitution in the E2 envelope protein escapes neutralization by naturally-induced and...

    ID: 1811952

    Description: epitope description:QLINTNGSWHINSTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 20433800;

  51. Determination of glycated nucleobases in human urine by a new monoclonal antibody specific for N2-carboxyethyl-2'-deoxyguanosine.

    ID: 1811965

    Description: epitope description:N(2)-carboxyethyl-2'-deoxyguanosine host organism:Mus musculus BALB/c antibody name:MAb M-5.1.6

    Publication: 15487900;

  52. Use of an artificial antigen containing the 3,6-di-O-methyl-beta-D-glucopyranosyl epitope for the serodiagnosis of leprosy.

    ID: 1811977

    Description: epitope description:beta-D-Glcp3,6Me2-(1->4)-alpha-L-Rhap2,3-Me2 antigen name:phenolic glycolipid-1 host organism:Homo sapiens

    Publication: 6207246;

  53. Antibodies to liposomal phosphatidylcholine and phosphatidylsulfocholine.

    ID: 1811981

    Description: epitope description:1,2-di-O-myristoyl-sn-glycero-3-phosphosulfocholine host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2190620;

  54. Anti-Klebsiella K30 phospholipid antibodies in systemic lupus erythematosus: antigen cross-reactions and idiotypic sharing with antibodies to DNA and ...

    ID: 1811988

    Description: epitope description:phosphatidylethanolamine host organism:Homo sapiens

    Publication: 3261736;

  55. Anti-Klebsiella K30 phospholipid antibodies in systemic lupus erythematosus: antigen cross-reactions and idiotypic sharing with antibodies to DNA and ...

    ID: 1812000

    Description: epitope description:phosphatidyl-L-serine host organism:Homo sapiens

    Publication: 3261736;

  56. Motor nerve terminal degeneration provides a potential mechanism for rapid recovery in acute motor axonal neuropathy after Campylobacter infection.

    ID: 1812012

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 9065554;

  57. Motor nerve terminal degeneration provides a potential mechanism for rapid recovery in acute motor axonal neuropathy after Campylobacter infection.

    ID: 1812015

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer antigen name:lipopolysaccharide host organism:Hom...

    Publication: 9065554;

  58. Elicited antibodies in baboons exposed to tissues from alpha1,3-galactosyltransferase gene-knockout pigs.

    ID: 1812055

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Papio hamadryas

    Publication: 16612284;

  59. Evaluation of progesterone-ovalbumin conjugates with different length linkers in enzyme-linked immunosorbant assay and surface plasmon resonance-based...

    ID: 1812059

    Description: epitope description:2,5-dioxo-1-pyrrolidinyl 6-(6-{3-[(progesterone-4-yl)thiopropionyl]aminohexanoyl}amino)hexanoate host organism:Rattus norvegicus

    Publication: 11996928;

  60. Evaluation of progesterone-ovalbumin conjugates with different length linkers in enzyme-linked immunosorbant assay and surface plasmon resonance-based...

    ID: 1812061

    Description: epitope description:2,5-dioxo-1-pyrrolidinyl 6-(6-{3-[(progesterone-4-yl)thiopropionyl]aminohexanoyl}amino)hexanoate host organism:Rattus norvegicus

    Publication: 11996928;

  61. Mucosal immunogenicity of polysaccharides conjugated to a peptide or multiple-antigen peptide containing T- and B-cell epitopes.

    ID: 1812066

    Description: epitope description:YEKEPTPPTRTPDQ antigen name:UniProt:I6TX52 host organism:Rattus norvegicus

    Publication: 7790080;

  62. Mucosal immunogenicity of polysaccharides conjugated to a peptide or multiple-antigen peptide containing T- and B-cell epitopes.

    ID: 1812067

    Description: epitope description:YEKEPTPPTRTPDQ antigen name:UniProt:I6TX52 host organism:Rattus norvegicus

    Publication: 7790080;

  63. Mucosal immunogenicity of polysaccharides conjugated to a peptide or multiple-antigen peptide containing T- and B-cell epitopes.

    ID: 1812070

    Description: epitope description:YEKEPTPPTRTPDQ antigen name:UniProt:I6TX52 host organism:Rattus norvegicus

    Publication: 7790080;

  64. Quantitative determination of human IgG antibodies to the peptide subunit determinant of peptidoglycan by an enzyme-linked immunosorbent assay.

    ID: 1812076

    Description: epitope description:AAA + D-aa(A3) host organism:Homo sapiens

    Publication: 2410775;

  65. Quantitative determination of human IgG antibodies to the peptide subunit determinant of peptidoglycan by an enzyme-linked immunosorbent assay.

    ID: 1812077

    Description: epitope description:GGAAA + D-aa(A4, A5) host organism:Homo sapiens

    Publication: 2410775;

  66. Quantitative determination of human IgG antibodies to the peptide subunit determinant of peptidoglycan by an enzyme-linked immunosorbent assay.

    ID: 1812085

    Description: epitope description:AAA + D-aa(A1, A2, A3) host organism:Homo sapiens

    Publication: 2410775;

  67. Quantitative determination of human IgG antibodies to the peptide subunit determinant of peptidoglycan by an enzyme-linked immunosorbent assay.

    ID: 1812086

    Description: epitope description:AAA + D-aa(A1, A2, A3) host organism:Homo sapiens

    Publication: 2410775;

  68. Heterogeneity of the human phosphocholine-specific B cell repertoire.

    ID: 1812098

    Description: epitope description:phosphocholine host organism:Homo sapiens

    Publication: 6198388;

  69. Heterogeneity of the human phosphocholine-specific B cell repertoire.

    ID: 1812100

    Description: epitope description:phosphocholine host organism:Homo sapiens

    Publication: 6198388;

  70. The immunogenicity of dinitrophenyl amino acids.

    ID: 1812114

    Description: epitope description:2,4-dinitrophenyl group host organism:Cavia porcellus Albino Himalayan Fullingsdorf

    Publication: 4981513;

  71. Terminal beta-linked tyvelose creates unique epitopes in Trichinella spiralis glycan antigens.

    ID: 1812115

    Description: epitope description:beta-D-Tyvp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-OMe antigen name:N-glycan host organism:Rattus norve...

    Publication: 9147047;

  72. Autoantibodies against N-homocysteinylated proteins in humans: implications for atherosclerosis.

    ID: 1812140

    Description: epitope description:N(2)-acetyl-L-lysine host organism:Homo sapiens

    Publication: 15131313;

  73. Antibodies to liposomal phosphatidylcholine and phosphatidylsulfocholine.

    ID: 1812161

    Description: epitope description:lipid A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2190620;

  74. Deficiency of N-glycolylneuraminic acid and Galalpha1-3Galbeta1-4GlcNAc epitopes in xenogeneic cells attenuates cytotoxicity of human natural antibodi...

    ID: 1812173

    Description: epitope description:N-glycoloyl-beta-neuraminic acid host organism:Gallus gallus antibody name:HU/Ch2-7

    Publication: 21158945;

  75. Spectrotype analysis and clonal characteristics of human anti-Gal alpha1-3Gal antibodies.

    ID: 1812193

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Homo sapiens

    Publication: 12060461;

  76. Ribosome structure: localization of N6,N6-dimethyladenosine by electron microscopy of a ribosome-antibody complex.

    ID: 1812196

    Description: epitope description:N(6),N(6)-dimethyladenosine antigen name:30S ribosomal protein S2 host organism:Oryctolagus cuniculus

    Publication: 323854;

  77. Ribosome structure: localization of N6,N6-dimethyladenosine by electron microscopy of a ribosome-antibody complex.

    ID: 1812198

    Description: epitope description:N(6),N(6)-dimethyladenosine antigen name:30S ribosomal protein S2 host organism:Oryctolagus cuniculus

    Publication: 323854;

  78. Ribosome structure: localization of N6,N6-dimethyladenosine by electron microscopy of a ribosome-antibody complex.

    ID: 1812199

    Description: epitope description:N(6),N(6)-dimethyladenosine antigen name:30S ribosomal protein S2 host organism:Oryctolagus cuniculus

    Publication: 323854;

  79. Ribosome structure: localization of N6,N6-dimethyladenosine by electron microscopy of a ribosome-antibody complex.

    ID: 1812203

    Description: epitope description:N(6),N(6)-dimethyladenosine antigen name:30S ribosomal protein S2 host organism:Oryctolagus cuniculus

    Publication: 323854;

  80. Autoimmunity after induction of neonatal tolerance to alloantigens: role of B cell chimerism and F1 donor B cell activation.

    ID: 1812207

    Description: epitope description:fluorescein isothiocyanate host organism:Mus musculus BALB/c

    Publication: 2940295;

  81. Role of anti-Gal alpha13Gal and anti-platelet antibodies in hyperacute rejection of pig lung by human blood.

    ID: 1812322

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Homo sapiens

    Publication: 11722065;

  82. alpha-galactosyl epitopes on glycoproteins of porcine renal extracellular matrix.

    ID: 1812361

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Papio anubis

    Publication: 10652044;

  83. Two human IgM myeloma proteins with unusual specificities for streptococcal carbohydrate-associated epitopes.

    ID: 1812367

    Description: epitope description:alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->2)-alpha-L-Rhap antigen name:polysaccharide host organism:Homo sapiens an...

    Publication: 2579417;

  84. A mutant KcsA K(+) channel with altered conduction properties and selectivity filter ion distribution.

    ID: 1812368

    Description: epitope description:Y45, L49, R52, G53, A54, P55, G56, A57, Q58, I60, T61, Y62, R64 host organism:Mus musculus antibody name:Fab

    Publication: 15099749;

  85. Immunochemical analysis of the types Ia and Ib group B streptococcal polysaccharides.

    ID: 1812378

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-[beta-D-Glcp-(1->4)]-beta-D-Galp antigen name:polysaccharide host or...

    Publication: 3934276;

  86. Binding studies with antibodies having phosphorylcholine specificity and fragments derived from their homologous Streptococcus pneumoniae type 27 caps...

    ID: 1812380

    Description: epitope description:phosphocholine antigen name:polysaccharide host organism:Oryctolagus cuniculus

    Publication: 87460;

  87. Potential role of molecular mimicry between Helicobacter pylori lipopolysaccharide and host Lewis blood group antigens in autoimmunity.

    ID: 1812389

    Description: epitope description:beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta...

    Publication: 8675304;

  88. Potential role of molecular mimicry between Helicobacter pylori lipopolysaccharide and host Lewis blood group antigens in autoimmunity.

    ID: 1812390

    Description: epitope description:beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta...

    Publication: 8675304;

  89. Synthetic disialylgalactose immunoadsorbents deplete anti-GQ1b antibodies from autoimmune neuropathy sera.

    ID: 1812393

    Description: epitope description:alpha-NeupAc-(2->8)-alpha-NeupAc-(2->3)-beta-D-Galp host organism:Homo sapiens

    Publication: 14960498;

  90. Synthetic disialylgalactose immunoadsorbents deplete anti-GQ1b antibodies from autoimmune neuropathy sera.

    ID: 1812394

    Description: epitope description:alpha-NeupAc-(2->8)-alpha-NeupAc-(2->3)-beta-D-Galp host organism:Homo sapiens

    Publication: 14960498;

  91. The occupancy of ions in the K+ selectivity filter: charge balance and coupling of ion binding to a protein conformational change underlie high conduc...

    ID: 1812402

    Description: epitope description:Y45, L49, A50, R52, G53, A54, P55, G56, A57, Q58, I60, T61, Y62, P63, R64 host organism:Mus musculus antibody name:Fab

    Publication: 14583193;

  92. Potential role of molecular mimicry between Helicobacter pylori lipopolysaccharide and host Lewis blood group antigens in autoimmunity.

    ID: 1812407

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-D-Glcp antigen name:Other Homo sapiens (human) p...

    Publication: 8675304;

  93. Guillain-Barré syndrome- and Miller Fisher syndrome-associated Campylobacter jejuni lipopolysaccharides induce anti-GM1 and anti-GQ1b Antibodie...

    ID: 1812410

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 11254608;

  94. Potential role of molecular mimicry between Helicobacter pylori lipopolysaccharide and host Lewis blood group antigens in autoimmunity.

    ID: 1812413

    Description: epitope description:beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta...

    Publication: 8675304;

  95. Determination of glycated nucleobases in human urine by a new monoclonal antibody specific for N2-carboxyethyl-2'-deoxyguanosine.

    ID: 1812414

    Description: epitope description:(R)-N(2)-carboxyethyl-2'-deoxyguanosine host organism:Mus musculus BALB/c antibody name:MAb M-5.1.6

    Publication: 15487900;

  96. Guillain-Barré syndrome- and Miller Fisher syndrome-associated Campylobacter jejuni lipopolysaccharides induce anti-GM1 and anti-GQ1b Antibodie...

    ID: 1812424

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 11254608;

  97. Guillain-Barré syndrome- and Miller Fisher syndrome-associated Campylobacter jejuni lipopolysaccharides induce anti-GM1 and anti-GQ1b Antibodie...

    ID: 1812430

    Description: epitope description:ganglioside GM2 host organism:Homo sapiens

    Publication: 11254608;

  98. Guillain-Barré syndrome- and Miller Fisher syndrome-associated Campylobacter jejuni lipopolysaccharides induce anti-GM1 and anti-GQ1b Antibodie...

    ID: 1812445

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 11254608;

  99. Guillain-Barré syndrome- and Miller Fisher syndrome-associated Campylobacter jejuni lipopolysaccharides induce anti-GM1 and anti-GQ1b Antibodie...

    ID: 1812448

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 11254608;

  100. Guillain-Barré syndrome- and Miller Fisher syndrome-associated Campylobacter jejuni lipopolysaccharides induce anti-GM1 and anti-GQ1b Antibodie...

    ID: 1812452

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 11254608;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston