Hsp70 vaccination-induced antibodies recognize B cell epitopes in the cell wall of Mycobacterium avium subspecies paratuberculosis.

ID: 1818748

Description: epitope description:AQAGGPDGAAAGGG antigen name:Chaperone protein DnaK host organism:Capra hircus Saanen

Characterization of the epitope recognized by a monoclonal antibody highly specific for blood group M antigen.

ID: 1818755

Description: epitope description:S20 antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:M2A1

Human monoclonal antibody with T-cell-like specificity recognizes MHC class I self-peptide presented by HLA-DR1 on activated cells.

ID: 1818761

Description: epitope description:SDWRFLRGYHQYA antigen name:HLA class I histocompatibility antigen, A-2 alpha chain host organism:Homo sapiens antibody name:UL-5A1

Genetics of the phosphocholine-specific antibody response to Streptococcus pneumoniae. Germ-line but not mutated T15 antibodies are dominantly selecte...

ID: 1818773

Description: epitope description:phosphocholine antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:252.5E10; 252.5E11; 174.2E10; 253.12D3;...

Rational design and immunogenicity of liposome-based diepitope constructs: application to synthetic oligosaccharides mimicking the Shigella flexneri 2...

ID: 1818778

Description: epitope description:alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-[alpha-D-Glcp-(1->4)]-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap-(1->2)-alpha-...

Rational design and immunogenicity of liposome-based diepitope constructs: application to synthetic oligosaccharides mimicking the Shigella flexneri 2...

ID: 1818779

Description: epitope description:alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-[alpha-D-Glcp-(1->4)]-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap-(1->2)-alpha-...

Anti-pig IgM antibodies in human serum react predominantly with Gal(alpha 1-3)Gal epitopes.

ID: 1818780

Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactosyl group host organism:Homo sapiens

Neutralizing antibody responses of pigs infected with natural GP5 N-glycan mutants of porcine reproductive and respiratory syndrome virus.

ID: 1818785

Description: epitope description:FADGNGDSSTYQYIYNLTICELNG antigen name:Glycoprotein 5 host organism:Sus scrofa

Neutralizing antibody responses of pigs infected with natural GP5 N-glycan mutants of porcine reproductive and respiratory syndrome virus.

ID: 1818810

Description: epitope description:CELNGTDWLA antigen name:Glycoprotein 5 host organism:Sus scrofa

Neutralizing antibody responses of pigs infected with natural GP5 N-glycan mutants of porcine reproductive and respiratory syndrome virus.

ID: 1818811

Description: epitope description:SSHLQLIYNLTLC antigen name:Glycoprotein 5 host organism:Sus scrofa

Characterization of the epitope recognized by a monoclonal antibody highly specific for blood group M antigen.

ID: 1818813

Description: epitope description:S20 antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:M2A1

HLA-DR beta chain residues that are predicted to be located in the floor of the peptide-binding groove contribute to antibody-binding epitopes.

ID: 1818824

Description: epitope description:Y5, T7, T46 antigen name:HLA class II histocompatibility antigen, DRB1-11 beta chain host organism:Mus musculus BALB/c antibody na...

Antibodies to keyhole limpet hemocyanin cross-react with an epitope on the polysaccharide capsule of Cryptococcus neoformans and other carbohydrates: ...

ID: 1818889

Description: epitope description:LQYTPSWMLV host organism:Mus musculus BALB/c

Antibodies to keyhole limpet hemocyanin cross-react with an epitope on the polysaccharide capsule of Cryptococcus neoformans and other carbohydrates: ...

ID: 1818905

Description: epitope description:FGGETFTPDWMMEV host organism:Mus musculus BALB/c

Antibodies to keyhole limpet hemocyanin cross-react with an epitope on the polysaccharide capsule of Cryptococcus neoformans and other carbohydrates: ...

ID: 1818910

Description: epitope description:AFTPDWMMEVAIDNE host organism:Mus musculus BALB/c

Antibodies to keyhole limpet hemocyanin cross-react with an epitope on the polysaccharide capsule of Cryptococcus neoformans and other carbohydrates: ...

ID: 1818913

Description: epitope description:CKVMVHDPHSLA antigen name:H-2 class I histocompatibility antigen, K-B alpha chain host organism:Mus musculus BALB/c

A novel glycosphingolipid expressed in pig kidney: Gal alpha 1-3Lewis(x) hexaglycosylceramide.

ID: 1818965

Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer hos...

A novel glycosphingolipid expressed in pig kidney: Gal alpha 1-3Lewis(x) hexaglycosylceramide.

ID: 1818968

Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Gl...

A somatically mutated human antiganglioside IgM antibody that induces experimental neuropathy in mice is encoded by the variable region heavy chain ge...

ID: 1818973

Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

Neutralizing human monoclonal antibodies binding multiple serotypes of botulinum neurotoxin.

ID: 1818981

Description: epitope description:YNQYTEEEK antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:4E17

Neutralizing human monoclonal antibodies binding multiple serotypes of botulinum neurotoxin.

ID: 1818986

Description: epitope description:YNQYTEEEK antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:4E17

Further evidence that carbohydrates are the immunodeterminant structures of blood group M and N specificities.

ID: 1819004

Description: epitope description:beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-D-Glc host organism:Equus caballus

Recombinant infectious bursal disease virus carrying hepatitis C virus epitopes.

ID: 1819015

Description: epitope description:EQKLISEEDL antigen name:Myc proto-oncogene protein (UniProt:P01106) host organism:Mus musculus BALB/c antibody name:Myc1-9E10

Improved removal of anti-A and anti-B antibodies from plasma using blood-group-active haptens.

ID: 1819016

Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp host organism:Homo sapiens

Improved removal of anti-A and anti-B antibodies from plasma using blood-group-active haptens.

ID: 1819017

Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp host organism:Homo sapiens

Peptide mimics as surrogate immunogens of mosquito midgut carbohydrate malaria transmission blocking targets.

ID: 1819023

Description: epitope description:LFSPWLRVQNHF host organism:Oryctolagus cuniculus New Zealand White

Peptide mimics as surrogate immunogens of mosquito midgut carbohydrate malaria transmission blocking targets.

ID: 1819036

Description: epitope description:AGVLRQEQANSV host organism:Mus musculus BALB/c antibody name:MG96

Peptide mimics as surrogate immunogens of mosquito midgut carbohydrate malaria transmission blocking targets.

ID: 1819039

Description: epitope description:SEAKDGSHGEGK host organism:Mus musculus BALB/c antibody name:MG96

Peptide mimics as surrogate immunogens of mosquito midgut carbohydrate malaria transmission blocking targets.

ID: 1819103

Description: epitope description:LKGDDSAGEQEL host organism:Mus musculus BALB/c antibody name:MG96

Posttranslationally modified peptides efficiently mimicking neoantigens: a challenge for theragnostics of autoimmune diseases.

ID: 1819201

Description: epitope description:TPRVERNGHSVFLAPYGWMVK + GLUC(N7) host organism:Homo sapiens

Posttranslationally modified peptides efficiently mimicking neoantigens: a challenge for theragnostics of autoimmune diseases.

ID: 1819202

Description: epitope description:TPRVERQGHSVFLAPYGWMVK + GLUC(Q7) host organism:Homo sapiens

Posttranslationally modified peptides efficiently mimicking neoantigens: a challenge for theragnostics of autoimmune diseases.

ID: 1819205

Description: epitope description:D-glucosyl group host organism:Homo sapiens

Posttranslationally modified peptides efficiently mimicking neoantigens: a challenge for theragnostics of autoimmune diseases.

ID: 1819206

Description: epitope description:D-glucosyl group host organism:Homo sapiens

Adduction of cholesterol 5,6-secosterol aldehyde to membrane-bound myelin basic protein exposes an immunodominant epitope.

ID: 1819212

Description: epitope description:VVHFFKNIVTPRT antigen name:Myelin basic protein host organism:Mus musculus antibody name:QD9

Rapid recruitment and activation of macrophages by anti-Gal/alpha-Gal liposome interaction accelerates wound healing.

ID: 1819238

Description: epitope description:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-D-GlcNAc host organism:Mus musculus N-acetylgalactosaminyltransferase null

Strain-transcending Fc-dependent killing of Plasmodium falciparum by merozoite surface protein 2 allele-specific human antibodies.

ID: 1819244

Description: epitope description:ESSSSGNAPNKTDGKGEESEKQNELNESTEEGPKAPQEPQTAENENPA antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein...

Protective immunity against Chlamydia trachomatis genital infection induced by a vaccine based on the major outer membrane multi-epitope human papillo...

ID: 1819274

Description: epitope description:GDNENQSTVKTNSVPNMSLDQSVVELYTWQASLALSYRLNMFTPYIGV host organism:Oryctolagus cuniculus

Rodents infected with Schistosoma mansoni produce cytolytic IgG and IgM antibodies to the Lewis x antigen.

ID: 1819311

Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc host organism:Mus musculus Swiss Webster

Structure of IL-17A in complex with a potent, fully human neutralizing antibody.

ID: 1819320

Description: epitope description:A: S63, S64, D65, Y66, R69; B: L97, Y108, H109, M110, N111, P149, I150 antigen name:Interleukin-17A host organism:Homo sapiens ant...

Anti-group A streptococcal vaccine epitope: structure, stability, and its ability to interact with HLA class II molecules.

ID: 1819391

Description: epitope description:KGLRRDLDASREAKKQLEAE antigen name:UniProt:A2RGM0 host organism:Homo sapiens

Anti-group A streptococcal vaccine epitope: structure, stability, and its ability to interact with HLA class II molecules.

ID: 1819392

Description: epitope description:KGLRRDLDASREAKKQVEKA antigen name:UniProt:A2RGM0 host organism:Homo sapiens

Anti-group A streptococcal vaccine epitope: structure, stability, and its ability to interact with HLA class II molecules.

ID: 1819394

Description: epitope description:RRDLDASREAKKQLEAEQQK antigen name:UniProt:A2RGM0 host organism:Homo sapiens

Anti-group A streptococcal vaccine epitope: structure, stability, and its ability to interact with HLA class II molecules.

ID: 1819400

Description: epitope description:KLEEQNKISEASRKGLRRDL antigen name:UniProt:A2RGM0 host organism:Homo sapiens

Immunological evidence for methylglyoxal-derived modifications in vivo. Determination of antigenic epitopes.

ID: 1824310

Description: epitope description:methylglyoxal host organism:Oryctolagus cuniculus New Zealand White

Immunological evidence for methylglyoxal-derived modifications in vivo. Determination of antigenic epitopes.

ID: 1824311

Description: epitope description:methylglyoxal host organism:Oryctolagus cuniculus New Zealand White

Expression of a blood group B antigen-related glycoepitope in human dorsal root ganglion cells.

ID: 1824347

Description: epitope description:alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal antigen name:glycoprotein host organism:Mus musculus antibody name:3E-7

Monoclonal antibodies directed to the blood group A associated structure, galactosyl-A: specificity and relation to the Thomsen-Friedenreich antigen.

ID: 1824352

Description: epitope description:beta-D-Gal-(1->3-)-alpha-D-GalNAc antigen name:glycolipid host organism:Mus musculus BALB/c antibody name:HH8

Monoclonal antibodies directed to the blood group A associated structure, galactosyl-A: specificity and relation to the Thomsen-Friedenreich antigen.

ID: 1824355

Description: epitope description:beta-D-Gal-(1->3-)-alpha-D-GalNAc antigen name:glycolipid host organism:Homo sapiens

Antigenic structures recognized by anti-beta2-glycoprotein I auto-antibodies.

ID: 1824522

Description: epitope description:HNIWSAPRLIFN host organism:Homo sapiens antibody name:EY2C9

Antigenic structures recognized by anti-beta2-glycoprotein I auto-antibodies.

ID: 1824543

Description: epitope description:SLWQDRLNAMQS host organism:Mus musculus NZW X BXSB antibody name:WB-CAL-1

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824583

Description: epitope description:DQQLANLDLNSEKQSGGA antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824585

Description: epitope description:SGGASTASKGRYIPPHLR antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824586

Description: epitope description:ASTASKGRYIPPHLRNKEA antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824588

Description: epitope description:EASKGFHDKDSSGWSCSK antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824591

Description: epitope description:AYSSFGSRDSRGKPGYF antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824596

Description: epitope description:DGIGNRERPGFGRFERSGH antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824597

Description: epitope description:PGFGRFERSGHSRWCDK antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824605

Description: epitope description:VEATGSNCPPHIENFSDI antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824606

Description: epitope description:CPPHIENFSDIDMGEIIM antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824609

Description: epitope description:ELTRYTRPTPVQKHAIPI antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824615

Description: epitope description:SQIYTDGPGEALKAVKENGR antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824616

Description: epitope description:EALKAVKENGRYGRRKQY antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824621

Description: epitope description:EEARKFSYRSRVRPCVVY antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824629

Description: epitope description:YLVLDEADRMLDMGFEPQI antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824632

Description: epitope description:EQDTMPPKGVRHTMMFSA antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824634

Description: epitope description:MMFSATFPKEIQMLARDF antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824635

Description: epitope description:PKEIQMLARDFLDEYIFL antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824646

Description: epitope description:GYACTSIHGDRSQRDREEA antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824660

Description: epitope description:LDLLVEAKQEVPSWLENM antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824663

Description: epitope description:EHHYKGGSRGRSKSNRF antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Minor histocompatibility antigen DBY elicits a coordinated B and T cell response after allogeneic stem cell transplantation.

ID: 1824666

Description: epitope description:FGARDYRQSSGSSSSGF antigen name:ATP-dependent RNA helicase DDX3Y host organism:Homo sapiens

Sequence changes at the V-D junction of the VH1 heavy chain of anti-phosphocholine antibodies alter binding to and protection against Streptococcus pn...

ID: 1824727

Description: epitope description:6-(O-phosphocholine)oxyhexanoate host organism:Mus musculus CBA/CaHN-Btkxid/J antibody name:31-23-1, 31-34-2, 32-11-1, 24.1B10, 24...

Schistosoma mansoni infection in humans and primates induces cytolytic antibodies to surface Le(x) determinants on myeloid cells.

ID: 1824761

Description: epitope description:beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-D-Glc host organism:Homo sapiens

Schistosoma mansoni infection in humans and primates induces cytolytic antibodies to surface Le(x) determinants on myeloid cells.

ID: 1824763

Description: epitope description:beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-D-Glc host organism:Homo sapiens

Characterization of blood-group-ABO(H)-active glycosphingolipids in type-AB human erythrocytes.

ID: 1824779

Description: epitope description:alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal antigen name:glycolipid host organism:Mus musculus

Three types of blood group I specificity among monoclonal anti-I autoantibodies revealed by analogues of a branched erythrocyte glycolipid.

ID: 1824830

Description: epitope description:beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[beta-D-GlcNAc-(1->6)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-...

Three types of blood group I specificity among monoclonal anti-I autoantibodies revealed by analogues of a branched erythrocyte glycolipid.

ID: 1824833

Description: epitope description:beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organ...

Surface topology of the Escherichia coli K-12 ferric enterobactin receptor.

ID: 1824840

Description: epitope description:EPTDTPVSHDDTIVVTAAEQNLQ antigen name:Ferrienterobactin receptor host organism:Mus musculus BALB/c antibody name:29

ABH and Lewis antigens on lymphocytes: screening of pregnant women's sera with the B-cell cytotoxicity test.

ID: 1824857

Description: epitope description:alpha-L-Fucp-(1->2)-[beta-D-GalpNAc-(1->3)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-D-Galp host organism:Homo sapiens

Identification of the antigenic determinants of factors 8, 9, and 34 of genus Candida.

ID: 1824866

Description: epitope description:alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-D-Manp antigen name:mannan host organism:Oryctolagus cuniculus antibody name:FAb 34

Schistosoma mansoni: immunolocalization of two different fucose-containing carbohydrate epitopes.

ID: 1824882

Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-D-Glcp antigen name:glycoprotein host organism:M...

Peptide mimotopes of Mycobacterium tuberculosis carbohydrate immunodeterminants.

ID: 1825283

Description: epitope description:QEPLMGTVPIRA host organism:Oryctolagus cuniculus New Zealand White

Remodeling of the major mouse xenoantigen, Galalpha1-3Galbeta1-4GlcNAc-R, by N-acetylglucosaminyltransferase-III.

ID: 1826178

Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus antibody name:MG237

Antibody response in an ABO-incompatible blood transfusion. Antigen specificity and immunoglobulin class.

ID: 1826202

Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-D-GlcpNAc host organism:Homo sapiens

Antibody response in an ABO-incompatible blood transfusion. Antigen specificity and immunoglobulin class.

ID: 1826210

Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GalpNAc host organism:Homo sapiens

Antibody response in an ABO-incompatible blood transfusion. Antigen specificity and immunoglobulin class.

ID: 1826215

Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-D-GlcpNAc host organism:Homo sapiens

Antibody response in an ABO-incompatible blood transfusion. Antigen specificity and immunoglobulin class.

ID: 1826218

Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GalpNAc host organism:Homo sapiens

A cytotoxic human hybridoma monoclonal antibody (TrJ5) specific for HLA-B38(16) and -B39(16).

ID: 1826717

Description: epitope description:T158 antigen name:HLA class I histocompatibility antigen, B-39 alpha chain host organism:Homo sapiens antibody name:TrJ5

Epitope specificity of rabbit immunoglobulin G (IgG) elicited by pneumococcal type 23F synthetic oligosaccharide- and native polysaccharide-protein co...

ID: 1827089

Description: epitope description:beta-D-Glc-(1->4)-[alpha-L-Rha-(1->2)]-3-O-(2-glycerylphospho)-beta-D-Gal-(1->4)-beta-L-Rha antigen name:polysaccharide host organ...

Epitope specificity of rabbit immunoglobulin G (IgG) elicited by pneumococcal type 23F synthetic oligosaccharide- and native polysaccharide-protein co...

ID: 1827090

Description: epitope description:beta-D-Glc-(1->4)-[alpha-L-Rha-(1->2)]-3-O-(2-glycerylphospho)-beta-D-Gal-(1->4)-beta-L-Rha antigen name:polysaccharide host organ...

Epitope specificity of rabbit immunoglobulin G (IgG) elicited by pneumococcal type 23F synthetic oligosaccharide- and native polysaccharide-protein co...

ID: 1827093

Description: epitope description:aldehydo-L-rhamnose antigen name:polysaccharide host organism:Oryctolagus cuniculus New Zealand White

Epitope specificity of rabbit immunoglobulin G (IgG) elicited by pneumococcal type 23F synthetic oligosaccharide- and native polysaccharide-protein co...

ID: 1827097

Description: epitope description:D-glucose antigen name:polysaccharide host organism:Oryctolagus cuniculus New Zealand White

Epitope specificity of rabbit immunoglobulin G (IgG) elicited by pneumococcal type 23F synthetic oligosaccharide- and native polysaccharide-protein co...

ID: 1827102

Description: epitope description:D-galactose antigen name:polysaccharide host organism:Oryctolagus cuniculus New Zealand White

Epitope specificity of rabbit immunoglobulin G (IgG) elicited by pneumococcal type 23F synthetic oligosaccharide- and native polysaccharide-protein co...

ID: 1827104

Description: epitope description:beta-L-Rhap-(1->4)-beta-D-Glcp-(1->4)-beta-D-Galp antigen name:polysaccharide host organism:Homo sapiens

Epitope specificity of rabbit immunoglobulin G (IgG) elicited by pneumococcal type 23F synthetic oligosaccharide- and native polysaccharide-protein co...

ID: 1827109

Description: epitope description:3-O-(H2O3P)-beta-D-Glcp-(1->4)-[alpha-L-Rhap-(1->2)]-beta-D-Galp host organism:Oryctolagus cuniculus New Zealand White

Epitope specificity of rabbit immunoglobulin G (IgG) elicited by pneumococcal type 23F synthetic oligosaccharide- and native polysaccharide-protein co...

ID: 1827112

Description: epitope description:beta-D-Glc-(1->4)-[alpha-L-Rha-(1->2)]-3-O-(2-glycerylphospho)-beta-D-Gal-(1->4)-beta-L-Rha antigen name:polysaccharide host organ...

Epitope specificity of rabbit immunoglobulin G (IgG) elicited by pneumococcal type 23F synthetic oligosaccharide- and native polysaccharide-protein co...

ID: 1827115

Description: epitope description:beta-D-Glc-(1->4)-[alpha-L-Rha-(1->2)]-3-O-(2-glycerylphospho)-beta-D-Gal-(1->4)-beta-L-Rha antigen name:polysaccharide host organ...

Serological and immunochemical characterization of anti-PP1Pk (anti-Tja) antibodies in blood group little p individuals. Blood group A type 4 recognit...

ID: 1827170

Description: epitope description:alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

Serological and immunochemical characterization of anti-PP1Pk (anti-Tja) antibodies in blood group little p individuals. Blood group A type 4 recognit...

ID: 1827179

Description: epitope description:N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide host organism:Hom...

Serological and immunochemical characterization of anti-PP1Pk (anti-Tja) antibodies in blood group little p individuals. Blood group A type 4 recognit...

ID: 1827203

Description: epitope description:alpha-GalNAc-(1->3)-[alpha-Fuc-(1->2)]-beta-Gal-(1->3)-alpha-GalNAc-(1->3)-[alpha-Fuc-(1->2)]-beta-Gal-(1->4)-beta-GlcNAc-(1->3)-b...