Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823833

    Description: epitope description:beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)-D-Gal antigen name:glycolipid host organism:Homo sapiens

    Publication: 6208947;

  2. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823848

    Description: epitope description:beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-...

    Publication: 6208947;

  3. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823851

    Description: epitope description:beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-...

    Publication: 6208947;

  4. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823864

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc antigen name:glycolipid host organism:Mus musculus BALB/c

    Publication: 6208947;

  5. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823881

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc antigen name:glycolipid host organism:H...

    Publication: 6208947;

  6. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823882

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc antigen name:glycolipid host organism:H...

    Publication: 6208947;

  7. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823886

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc antigen name:glycolipid host organism:H...

    Publication: 6208947;

  8. A-active trisaccharides isolated from A1 and A2 blood-group-specific glycoproteins.

    ID: 1823928

    Description: epitope description:alpha-D-GalpNAc-(1->3)-beta-D-Galp-(1->3)-D-GalNAc-ol antigen name:glycoprotein host organism:Homo sapiens

    Publication: 6172274;

  9. Identification of CD4+ T cell epitopes in C. burnetii antigens targeted by antibody responses.

    ID: 1824104

    Description: epitope description:DLRYHAPIYGAVHPR antigen name:Hypothetical exported protein (UniProt:Q83CG1) host organism:Mus musculus C57BL/6

    Publication: 21423609;

  10. Identification of CD4+ T cell epitopes in C. burnetii antigens targeted by antibody responses.

    ID: 1824105

    Description: epitope description:VHHYLVNHPEVLVEA antigen name:Outer membrane protein (UniProt:H7C7D7) host organism:Mus musculus C57BL/6

    Publication: 21423609;

  11. Isolated bovine spinal motoneurons have specific ganglioside antigens recognized by sera from patients with motor neuron disease and motor neuropathy.

    ID: 1824112

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 1383424;

  12. Isolated bovine spinal motoneurons have specific ganglioside antigens recognized by sera from patients with motor neuron disease and motor neuropathy.

    ID: 1824119

    Description: epitope description:beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 1383424;

  13. Isolated bovine spinal motoneurons have specific ganglioside antigens recognized by sera from patients with motor neuron disease and motor neuropathy.

    ID: 1824120

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Gc-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 1383424;

  14. The alpha-L-(1----2)-trirhamnopyranoside epitope on the group-specific polysaccharide of group B streptococci.

    ID: 1824257

    Description: epitope description:alpha-L-rhamnopyranose antigen name:polysaccharide host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1708356;

  15. Antibodies to HLA-E in nonalloimmunized males: pattern of HLA-Ia reactivity of anti-HLA-E-positive sera.

    ID: 1824290

    Description: epitope description:DTAAQI antigen name:HLA class I histocompatibility antigen, alpha chain E host organism:Homo sapiens

    Publication: 20610644;

  16. Antibodies to HLA-E in nonalloimmunized males: pattern of HLA-Ia reactivity of anti-HLA-E-positive sera.

    ID: 1824297

    Description: epitope description:A138, Y139, D140, G141, K142, D143, Y144, D158, T159, A160, A161, Q162, I163, S164 antigen name:HLA class I histocompatibility ant...

    Publication: 20610644;

  17. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816238

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 10751257;

  18. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816244

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 10751257;

  19. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816247

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 10751257;

  20. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816249

    Description: epitope description:ganglioside GM2 host organism:Homo sapiens

    Publication: 10751257;

  21. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816255

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 10751257;

  22. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816260

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 10751257;

  23. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816261

    Description: epitope description:ganglioside GM2 host organism:Homo sapiens

    Publication: 10751257;

  24. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816265

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 10751257;

  25. Further evidence that carbohydrates are the immunodeterminant structures of blood group M and N specificities.

    ID: 1816285

    Description: epitope description:beta-D-galactose host organism:Equus caballus

    Publication: 6169631;

  26. Design and characterization of highly immunogenic heat-stable enterotoxin of enterotoxigenic Escherichia coli K99(+).

    ID: 1816295

    Description: epitope description:NTFYCCELCCNPACAGCY antigen name:Heat-stable enterotoxin ST-IA/ST-P host organism:Oryctolagus cuniculus

    Publication: 21277302;

  27. Serodiagnosis of porcine reproductive and respiratory syndrome virus infection with the use of glycoprotein 5 antigens.

    ID: 1816320

    Description: epitope description:VIIEKRGKVEVEGHLID antigen name:Glycoprotein 5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20885848;

  28. Serodiagnosis of porcine reproductive and respiratory syndrome virus infection with the use of glycoprotein 5 antigens.

    ID: 1816328

    Description: epitope description:SHLQLIYNLTLCELNGTDW antigen name:Glycoprotein 5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20885848;

  29. Epitope mapping of HLA-B27 and HLA-B7 antigens by using intradomain recombinants.

    ID: 1816347

    Description: epitope description:D101, T104 antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus C57BL/6 X BALB/c antib...

    Publication: 2459214;

  30. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816352

    Description: epitope description:VDMRGDCWSIEY antigen name:Cysteine protease S273R host organism:Mus musculus BALB/c

    Publication: 21468582;

  31. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816360

    Description: epitope description:VQKKYGGGEDCECTRV antigen name:Polyprotein pp220 host organism:Mus musculus BALB/c

    Publication: 21468582;

  32. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816361

    Description: epitope description:INELKKEHTDKIQIVSKL antigen name:Polyprotein pp220 host organism:Mus musculus BALB/c

    Publication: 21468582;

  33. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816363

    Description: epitope description:MSRIFRGDNALNMGRPKFLSDQIFNKV antigen name:Polyprotein pp220 host organism:Mus musculus BALB/c

    Publication: 21468582;

  34. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816370

    Description: epitope description:LKEDSRDRT antigen name:Structural protein p14.5 host organism:Mus musculus BALB/c

    Publication: 21468582;

  35. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816376

    Description: epitope description:FEEETESSASSES antigen name:Phosphoprotein p30 host organism:Mus musculus BALB/c

    Publication: 21468582;

  36. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816377

    Description: epitope description:FEQEPSSEEPKDSKL antigen name:Phosphoprotein p30 host organism:Mus musculus BALB/c

    Publication: 21468582;

  37. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816378

    Description: epitope description:LKEEEKEVVRLMVIKLLKKNKL antigen name:Phosphoprotein p30 host organism:Mus musculus BALB/c

    Publication: 21468582;

  38. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816384

    Description: epitope description:LCNIHDLHKPHQSKPILTDENDTQRTCS antigen name:Major capsid protein host organism:Mus musculus BALB/c

    Publication: 21468582;

  39. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816389

    Description: epitope description:SEPELDMDLIEMEKSISEERLKN antigen name:Uncharacterized protein E301R host organism:Mus musculus BALB/c

    Publication: 21468582;

  40. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816390

    Description: epitope description:FEEDKKMLELFVQKL antigen name:Protein H339R host organism:Mus musculus BALB/c

    Publication: 21468582;

  41. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816411

    Description: epitope description:YCEYPGERLYENVRFDVNGNSLDEYSSDVTTL antigen name:Major capsid protein host organism:Sus scrofa

    Publication: 21468582;

  42. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816413

    Description: epitope description:QKDLVNEFPGLFIRQSRFIPGRPSRRNIRFKP antigen name:Major capsid protein host organism:Sus scrofa

    Publication: 21468582;

  43. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816417

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 9119976;

  44. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816419

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 9119976;

  45. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816421

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;

  46. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816425

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;

  47. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816428

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;

  48. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816430

    Description: epitope description:beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;

  49. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816432

    Description: epitope description:beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;

  50. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816435

    Description: epitope description:beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;

  51. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816438

    Description: epitope description:ganglioside GM2 host organism:Homo sapiens

    Publication: 9119976;

  52. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816450

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-beta-D-Gal-(1->4)-b...

    Publication: 9119976;

  53. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816451

    Description: epitope description:VDMRGDCWSIEY antigen name:Cysteine protease S273R host organism:Sus scrofa

    Publication: 21468582;

  54. Identification of IgE sequential epitopes of lentil (Len c 1) by means of peptide microarray immunoassay.

    ID: 1816480

    Description: epitope description:DLNLIGFGINAKNNQ antigen name:Len c 1 host organism:Homo sapiens

    Publication: 20816193;

  55. Identification of IgE sequential epitopes of lentil (Len c 1) by means of peptide microarray immunoassay.

    ID: 1816483

    Description: epitope description:NNQRNFLAGEEDNVI antigen name:Len c 1 host organism:Homo sapiens

    Publication: 20816193;

  56. Identification of IgE sequential epitopes of lentil (Len c 1) by means of peptide microarray immunoassay.

    ID: 1816487

    Description: epitope description:QRPVKELAFPGSSRE antigen name:Len c 1 host organism:Homo sapiens

    Publication: 20816193;

  57. Identification of IgE sequential epitopes of lentil (Len c 1) by means of peptide microarray immunoassay.

    ID: 1816488

    Description: epitope description:VKELAFPGSSREVDR antigen name:Len c 1 host organism:Homo sapiens

    Publication: 20816193;

  58. Identification of IgE sequential epitopes of lentil (Len c 1) by means of peptide microarray immunoassay.

    ID: 1816489

    Description: epitope description:LAFPGSSREVDRLLT antigen name:Len c 1 host organism:Homo sapiens

    Publication: 20816193;

  59. Antiserum against the conserved nine amino acid N-terminal peptide of influenza A virus matrix protein 2 is not immunoprotective.

    ID: 1816518

    Description: epitope description:SLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20965983;

  60. Antiserum against the conserved nine amino acid N-terminal peptide of influenza A virus matrix protein 2 is not immunoprotective.

    ID: 1816520

    Description: epitope description:SLLTEVETP antigen name:Matrix protein 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20965983;

  61. Identification of a conserved JEV serocomplex B-cell epitope by screening a phage-display peptide library with a mAb generated against West Nile virus...

    ID: 1816665

    Description: epitope description:KKPGGPG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:6D3

    Publication: 21375771;

  62. Identification of a conserved JEV serocomplex B-cell epitope by screening a phage-display peptide library with a mAb generated against West Nile virus...

    ID: 1816668

    Description: epitope description:KKPGGPG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:6D3

    Publication: 21375771;

  63. Hsp70 vaccination-induced antibodies recognize B cell epitopes in the cell wall of Mycobacterium avium subspecies paratuberculosis.

    ID: 1816690

    Description: epitope description:PDGAAAGGG antigen name:Chaperone protein DnaK host organism:Mus musculus BALB/c antibody name:KoKoB01

    Publication: 21199702;

  64. BBK07 immunodominant peptides as serodiagnostic markers of Lyme disease.

    ID: 1816709

    Description: epitope description:NLAKEAQDDSEKSK antigen name:Lipoprotein, putative host organism:Homo sapiens

    Publication: 21177911;

  65. BBK07 immunodominant peptides as serodiagnostic markers of Lyme disease.

    ID: 1816716

    Description: epitope description:KNGLKMVKLLDELL antigen name:Lipoprotein, putative host organism:Homo sapiens

    Publication: 21177911;

  66. BBK07 immunodominant peptides as serodiagnostic markers of Lyme disease.

    ID: 1816726

    Description: epitope description:KIENAAMAIHLCFNN antigen name:Lipoprotein, putative host organism:Homo sapiens

    Publication: 21177911;

  67. Carbohydrates on the surface of Echinococcus granulosus protoscoleces are immunodominant in mice.

    ID: 1816727

    Description: epitope description:alpha-D-galactose antigen name:N-glycan host organism:Mus musculus BALB/c

    Publication: 9226694;

  68. Carbohydrate phenotyping of human and animal milk glycoproteins.

    ID: 1816737

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-D-GlcpNAc host organism:Mus musculus antibody name:17-206

    Publication: 16133831;

  69. Carbohydrate phenotyping of human and animal milk glycoproteins.

    ID: 1816743

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc host organism:Mus musculus antibody name:92FR-A2

    Publication: 16133831;

  70. Carbohydrate phenotyping of human and animal milk glycoproteins.

    ID: 1816745

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-D-GlcpNAc host organism:Mus musculus antibody name:92FR-A2

    Publication: 16133831;

  71. Analysis of epitopes in the capsid protein of avian hepatitis E virus by using monoclonal antibodies.

    ID: 1816748

    Description: epitope description:LTYLRGISTKVTVGNIV antigen name:Non-structural polyprotein pORF1 host organism:Mus musculus BALB/c antibody name:7H12

    Publication: 21146559;

  72. Carbohydrate phenotyping of human and animal milk glycoproteins.

    ID: 1816761

    Description: epitope description:alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal host organism:Mus musculus antibody name:3E7

    Publication: 16133831;

  73. Analysis of epitopes in the capsid protein of avian hepatitis E virus by using monoclonal antibodies.

    ID: 1816767

    Description: epitope description:IRTQGIARGVRRLQAEHAQQFWFKVWELFTN antigen name:Non-structural polyprotein pORF1 host organism:Mus musculus BALB/c antibody name:1H5

    Publication: 21146559;

  74. Analysis of epitopes in the capsid protein of avian hepatitis E virus by using monoclonal antibodies.

    ID: 1816771

    Description: epitope description:IARGVRRLQA antigen name:Non-structural polyprotein pORF1 host organism:Mus musculus BALB/c antibody name:3A1

    Publication: 21146559;

  75. Carbohydrate phenotyping of human and animal milk glycoproteins.

    ID: 1816772

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcNAc host organism:Mus musculus antibody name:T218

    Publication: 16133831;

  76. Carbohydrate phenotyping of human and animal milk glycoproteins.

    ID: 1816773

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcNAc host organism:Mus musculus antibody name:T218

    Publication: 16133831;

  77. Analysis of epitopes in the capsid protein of avian hepatitis E virus by using monoclonal antibodies.

    ID: 1816779

    Description: epitope description:EDLINLS antigen name:Non-structural polyprotein pORF1 host organism:Mus musculus BALB/c antibody name:6G8

    Publication: 21146559;

  78. Carbohydrate phenotyping of human and animal milk glycoproteins.

    ID: 1816780

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc host organism:Mus musculus antibody name:P12

    Publication: 16133831;

  79. Carbohydrate phenotyping of human and animal milk glycoproteins.

    ID: 1816783

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc host organism:Mus musculus antibody name:P12

    Publication: 16133831;

  80. Carbohydrate phenotyping of human and animal milk glycoproteins.

    ID: 1816785

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc host organism:Mus musculus antibody name:P12

    Publication: 16133831;

  81. Carbohydrate phenotyping of human and animal milk glycoproteins.

    ID: 1816786

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc host organism:Mus musculus antibody name:KM93

    Publication: 16133831;

  82. Carbohydrate phenotyping of human and animal milk glycoproteins.

    ID: 1816788

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc host organism:Mus musculus antibody name:KM93

    Publication: 16133831;

  83. A broadly flavivirus cross-neutralizing monoclonal antibody that recognizes a novel epitope within the fusion loop of E protein.

    ID: 1816795

    Description: epitope description:MVDRGWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2A10G6

    Publication: 21264311;

  84. A broadly flavivirus cross-neutralizing monoclonal antibody that recognizes a novel epitope within the fusion loop of E protein.

    ID: 1816798

    Description: epitope description:MVDRGWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2A10G6

    Publication: 21264311;

  85. A broadly flavivirus cross-neutralizing monoclonal antibody that recognizes a novel epitope within the fusion loop of E protein.

    ID: 1816799

    Description: epitope description:MVDRGWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2A10G6

    Publication: 21264311;

  86. A broadly flavivirus cross-neutralizing monoclonal antibody that recognizes a novel epitope within the fusion loop of E protein.

    ID: 1816815

    Description: epitope description:MVDRGWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21264311;

  87. Characterisation and epitope mapping of neutralising monoclonal antibodies to A24 Cruzeiro strain of FMDV.

    ID: 1816822

    Description: epitope description:S138, M144 antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:1E12

    Publication: 21144677;

  88. Characterisation and epitope mapping of neutralising monoclonal antibodies to A24 Cruzeiro strain of FMDV.

    ID: 1816824

    Description: epitope description:G873, T728, S220, M293 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D9

    Publication: 21144677;

  89. Heterosubtypic protective immunity against influenza A virus induced by fusion peptide of the hemagglutinin in comparison to ectodomain of M2 protein.

    ID: 1816830

    Description: epitope description:SLLTEVETPIRNEWGSRSNDSSD host organism:Mus musculus BALB/c

    Publication: 21434706;

  90. Heterosubtypic protective immunity against influenza A virus induced by fusion peptide of the hemagglutinin in comparison to ectodomain of M2 protein.

    ID: 1816832

    Description: epitope description:SLLTEVETPIRNEWGSRSNDSSD host organism:Mus musculus BALB/c

    Publication: 21434706;

  91. Heterosubtypic protective immunity against influenza A virus induced by fusion peptide of the hemagglutinin in comparison to ectodomain of M2 protein.

    ID: 1816834

    Description: epitope description:GIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADL antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 21434706;

  92. Heterosubtypic protective immunity against influenza A virus induced by fusion peptide of the hemagglutinin in comparison to ectodomain of M2 protein.

    ID: 1816835

    Description: epitope description:GIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADL antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 21434706;

  93. Particular association of clinical and genetic features with autoimmunity to citrullinated alpha-enolase in rheumatoid arthritis.

    ID: 1816839

    Description: epitope description:KIHAREIFDSRGNPTVE + CITR(5R, 11R) antigen name:Alpha-enolase host organism:Homo sapiens

    Publication: 21360494;

  94. A somatically mutated human antiganglioside IgM antibody that induces experimental neuropathy in mice is encoded by the variable region heavy chain ge...

    ID: 1816957

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 8636426;

  95. A somatically mutated human antiganglioside IgM antibody that induces experimental neuropathy in mice is encoded by the variable region heavy chain ge...

    ID: 1816959

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-beta-D-Gal-(1->4)-b...

    Publication: 8636426;

  96. A somatically mutated human antiganglioside IgM antibody that induces experimental neuropathy in mice is encoded by the variable region heavy chain ge...

    ID: 1816964

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-[alpha-N-acetylneuraminosyl-(2->3...

    Publication: 8636426;

  97. Epitope mapping of the U1 small nuclear ribonucleoprotein particle in patients with systemic lupus erythematosus and mixed connective tissue disease.

    ID: 1816970

    Description: epitope description:PPAQPLSE antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 21362751;

  98. Epitope mapping of the U1 small nuclear ribonucleoprotein particle in patients with systemic lupus erythematosus and mixed connective tissue disease.

    ID: 1816983

    Description: epitope description:GMMPAPHM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 21362751;

  99. Epitope mapping of the U1 small nuclear ribonucleoprotein particle in patients with systemic lupus erythematosus and mixed connective tissue disease.

    ID: 1816985

    Description: epitope description:PDGPDGPE antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 21362751;

  100. Epitope mapping of the U1 small nuclear ribonucleoprotein particle in patients with systemic lupus erythematosus and mixed connective tissue disease.

    ID: 1816987

    Description: epitope description:PDGPDGPE antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 21362751;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston