Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Epitope mapping of the U1 small nuclear ribonucleoprotein particle in patients with systemic lupus erythematosus and mixed connective tissue disease.

    ID: 1816988

    Description: epitope description:EGPPPKDT antigen name:Small nuclear ribonucleoprotein-associated protein N host organism:Homo sapiens

    Publication: 21362751;

  2. Epitope mapping of the U1 small nuclear ribonucleoprotein particle in patients with systemic lupus erythematosus and mixed connective tissue disease.

    ID: 1816994

    Description: epitope description:CETNTGEV antigen name:Small nuclear ribonucleoprotein Sm D3 host organism:Homo sapiens

    Publication: 21362751;

  3. Epitope mapping of the U1 small nuclear ribonucleoprotein particle in patients with systemic lupus erythematosus and mixed connective tissue disease.

    ID: 1816998

    Description: epitope description:EEEEDGEM antigen name:Small nuclear ribonucleoprotein F host organism:Homo sapiens

    Publication: 21362751;

  4. Identification of B- and T-cell epitopes of BB, a carrier protein derived from the G protein of Streptococcus strain G148.

    ID: 1821171

    Description: epitope description:TVEGVKALIDEI antigen name:Immunoglobulin G-binding protein G host organism:Mus musculus BALB/c

    Publication: 12522050;

  5. Identification of B- and T-cell epitopes of BB, a carrier protein derived from the G protein of Streptococcus strain G148.

    ID: 1821179

    Description: epitope description:PKTDTYKLILNG antigen name:Immunoglobulin G-binding protein G host organism:Mus musculus BALB/c

    Publication: 12522050;

  6. Identification of B- and T-cell epitopes of BB, a carrier protein derived from the G protein of Streptococcus strain G148.

    ID: 1821184

    Description: epitope description:NGKTLKGETTTE antigen name:Immunoglobulin G-binding protein G host organism:Mus musculus BALB/c

    Publication: 12522050;

  7. Identification of B- and T-cell epitopes of BB, a carrier protein derived from the G protein of Streptococcus strain G148.

    ID: 1821188

    Description: epitope description:TTTEAVDAATAR antigen name:Immunoglobulin G-binding protein G host organism:Mus musculus BALB/c

    Publication: 12522050;

  8. Identification of B- and T-cell epitopes of BB, a carrier protein derived from the G protein of Streptococcus strain G148.

    ID: 1821189

    Description: epitope description:TEAVDAATARSF antigen name:Immunoglobulin G-binding protein G host organism:Mus musculus BALB/c

    Publication: 12522050;

  9. Removal of xenoreactive human anti-pig antibodies by absorption on recombinant mucin-containing glycoproteins carrying the Gal alpha1,3Gal epitope.

    ID: 1821200

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 9197365;

  10. Removal of xenoreactive human anti-pig antibodies by absorption on recombinant mucin-containing glycoproteins carrying the Gal alpha1,3Gal epitope.

    ID: 1821201

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 9197365;

  11. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821211

    Description: epitope description:FPEVFGKEKVNELSKDIGSE antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 21211944;

  12. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821213

    Description: epitope description:VEQKHIQKEDVPSERYLGYL antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 21211944;

  13. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821219

    Description: epitope description:VPQLEIVPNSAEERLHSMKE antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 21211944;

  14. Removal of anti-Galalpha1,3Gal xenoantibodies with an injectable polymer.

    ID: 1821223

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Macaca fascicularis

    Publication: 12488437;

  15. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821225

    Description: epitope description:YPYYAKPAAVRSPAQILQWQ antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  16. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821229

    Description: epitope description:YAKPAAVRSPAQILQWQVLS antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  17. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821238

    Description: epitope description:PAQILQWQVLSNTVPAKSCQ antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  18. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821244

    Description: epitope description:AKSCQAQPTTMARHPHPHLS antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  19. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821253

    Description: epitope description:PPKKNQDKTEIPTINTIASG antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  20. Removal of anti-Galalpha1,3Gal xenoantibodies with an injectable polymer.

    ID: 1821254

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Macaca fascicularis

    Publication: 12488437;

  21. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821257

    Description: epitope description:TINTIASGEPTSTPTTEAVE antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  22. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821260

    Description: epitope description:TIASGEPTSTPTTEAVESTV antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  23. Removal of anti-Galalpha1,3Gal xenoantibodies with an injectable polymer.

    ID: 1821270

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Macaca mulatta

    Publication: 12488437;

  24. Use of molecular modeling and site-directed mutagenesis to define the structural basis for the immune response to carbohydrate xenoantigens.

    ID: 1821285

    Description: epitope description:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-D-Glc host organism:Homo sapiens

    Publication: 17352819;

  25. Partial characterization of the cross-reacting determinant, a carbohydrate epitope shared by decay accelerating factor and the variant surface glycopr...

    ID: 1821298

    Description: epitope description:myo-inositol antigen name:Variant surface glycoprotein (VSG, atypical), putative (UniProt:Q57XH3) host organism:Oryctolagus cunicu...

    Publication: 2450138;

  26. Partial characterization of the cross-reacting determinant, a carbohydrate epitope shared by decay accelerating factor and the variant surface glycopr...

    ID: 1821301

    Description: epitope description:alpha-D-glucose 1-phosphate host organism:Oryctolagus cuniculus

    Publication: 2450138;

  27. Partial characterization of the cross-reacting determinant, a carbohydrate epitope shared by decay accelerating factor and the variant surface glycopr...

    ID: 1821303

    Description: epitope description:glycerol 1-phosphate host organism:Oryctolagus cuniculus

    Publication: 2450138;

  28. Partial characterization of the cross-reacting determinant, a carbohydrate epitope shared by decay accelerating factor and the variant surface glycopr...

    ID: 1821307

    Description: epitope description:alpha-D-glucose host organism:Oryctolagus cuniculus

    Publication: 2450138;

  29. Anti-carbohydrate antibodies associated with hyperacute rejection in a vascularized mouse heart-to-rat xenotransplantation model.

    ID: 1821311

    Description: epitope description:N-acetyl-alpha-D-galactosaminyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-be...

    Publication: 8623166;

  30. Are autoantibodies against Lewis antigens involved in the pathogenesis of Helicobacter pylori-induced peptic ulcers?

    ID: 1821316

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc antigen name:lipopolysaccharide host organism:Mus musc...

    Publication: 10449246;

  31. Molecular mimicry between GQ1b ganglioside and lipopolysaccharides of Campylobacter jejuni isolated from patients with Fisher's syndrome.

    ID: 1821343

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 7526777;

  32. Antistreptococcal group A antibodies: production after in vitro activation and hybridization of mouse spleen cells.

    ID: 1821354

    Description: epitope description:N-acetyl-D-glucosamine antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:20S7.1

    Publication: 7020569;

  33. Synthetic peptides homologous to human glycophorins of the Miltenberger complex of variants of MNSs blood group system specify the epitopes for Hil, S...

    ID: 1821368

    Description: epitope description:EISVTTVYPP antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 1718498;

  34. A murine monoclonal antibody against Kx protein which reacts also with beta-spectrin.

    ID: 1821403

    Description: epitope description:EEIEKE antigen name:Membrane transport protein XK host organism:Mus musculus BALB/c antibody name:3A12

    Publication: 10849386;

  35. A murine monoclonal antibody against Kx protein which reacts also with beta-spectrin.

    ID: 1821439

    Description: epitope description:EEIEKE antigen name:Membrane transport protein XK host organism:Mus musculus BALB/c antibody name:3A12

    Publication: 10849386;

  36. A murine monoclonal antibody against Kx protein which reacts also with beta-spectrin.

    ID: 1821455

    Description: epitope description:LAQELEKE antigen name:Spectrin beta chain, erythrocytic host organism:Mus musculus BALB/c antibody name:3A12

    Publication: 10849386;

  37. Characterization of porcine kidney neutral glycosphingolipids: identification of a carbohydrate antigen recognized by human natural antibodies.

    ID: 1821479

    Description: epitope description:alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide host organism:Rattus norvegicus Lewis antibody name:38....

    Publication: 7841803;

  38. High-dose porcine hematopoietic cell transplantation combined with CD40 ligand blockade in baboons prevents an induced anti-pig humoral response.

    ID: 1821487

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Papio anubis

    Publication: 10868629;

  39. Antibodies against beta-fibrin synthetic peptides: a study of their association with the immunogenetic background and disease course of rheumatoid art...

    ID: 1821622

    Description: epitope description:NKYRGTAGNALMDGASQL + CITR(R4) antigen name:Fibrinogen beta chain host organism:Homo sapiens

    Publication: 21295379;

  40. Antibodies against beta-fibrin synthetic peptides: a study of their association with the immunogenetic background and disease course of rheumatoid art...

    ID: 1821623

    Description: epitope description:NKYRGTAGNALMDGASQL + PALM(N1) antigen name:Fibrinogen beta chain host organism:Homo sapiens

    Publication: 21295379;

  41. Antibodies against beta-fibrin synthetic peptides: a study of their association with the immunogenetic background and disease course of rheumatoid art...

    ID: 1821632

    Description: epitope description:KYQISVNKYRGTAGNALMDGASQLMGENRT + CITR(R29) antigen name:Fibrinogen beta chain host organism:Homo sapiens

    Publication: 21295379;

  42. Antibodies against beta-fibrin synthetic peptides: a study of their association with the immunogenetic background and disease course of rheumatoid art...

    ID: 1821633

    Description: epitope description:KYQISVNKYRGTAGNALMDGASQLMGENRT + CITR(R10, R29) antigen name:Fibrinogen beta chain host organism:Homo sapiens

    Publication: 21295379;

  43. Carbohydrate residues downstream of the terminal Galalpha(1,3)Gal epitope modulate the specificity of xenoreactive antibodies.

    ID: 1821638

    Description: epitope description:methyl alpha-D-galactoside host organism:Mus musculus alpha-galactosyl transferase null antibody name:15.101

    Publication: 17724458;

  44. Carbohydrate residues downstream of the terminal Galalpha(1,3)Gal epitope modulate the specificity of xenoreactive antibodies.

    ID: 1821639

    Description: epitope description:methyl alpha-D-galactoside host organism:Mus musculus alpha-galactosyl transferase null antibody name:16.34

    Publication: 17724458;

  45. A novel pentaglycosylceramide in ostrich liver, IV4-beta-Gal-nLc4Cer, with terminal Gal(beta1-4)Gal, a xenoepitope recognized by human natural antibod...

    ID: 1821649

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Homo sapiens

    Publication: 10988247;

  46. Surface topology of the Escherichia coli K-12 ferric enterobactin receptor.

    ID: 1821689

    Description: epitope description:EPTDTPVSHDDTIVVTAAEQNLQ antigen name:Ferrienterobactin receptor host organism:Mus musculus BALB/c antibody name:29

    Publication: 2139651;

  47. Surface topology of the Escherichia coli K-12 ferric enterobactin receptor.

    ID: 1821710

    Description: epitope description:QALTGTNTGGAIDGVSTTD antigen name:Ferrienterobactin receptor host organism:Mus musculus BALB/c antibody name:24, 23

    Publication: 2139651;

  48. Analysis of the repertoire of human B-lymphocytes specific for type A and type B blood group terminal trisaccharide epitopes.

    ID: 1821756

    Description: epitope description:alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal host organism:Homo sapiens

    Publication: 7679803;

  49. Surface topology of the Escherichia coli K-12 ferric enterobactin receptor.

    ID: 1821927

    Description: epitope description:DINQGHQSARAGTYATTLPAGREG antigen name:Ferrienterobactin receptor host organism:Mus musculus BALB/c antibody name:33

    Publication: 2139651;

  50. Surface topology of the Escherichia coli K-12 ferric enterobactin receptor.

    ID: 1821929

    Description: epitope description:QALTGTNTGGAIDGVSTTD antigen name:Ferrienterobactin receptor host organism:Mus musculus BALB/c antibody name:23, 24

    Publication: 2139651;

  51. von Willebrand factor but not alpha-thrombin binding to platelet glycoprotein Ibalpha is influenced by the HPA-2 polymorphism.

    ID: 1821936

    Description: epitope description:DEGDTDLYDYYPEE antigen name:Platelet glycoprotein Ib alpha chain host organism:Mus musculus antibody name:27C11

    Publication: 12775575;

  52. Structural basis for distinctive recognition of fibrinogen gammaC peptide by the platelet integrin alphaIIbbeta3.

    ID: 1821941

    Description: epitope description:R108, N109, V110, G111, S112, Q113, L115, N180, I185, N189, S236, S237, R239, P240, G241, I242, L244, W245, H246 antigen name:Inte...

    Publication: 18710925;

  53. Removal of xenoreactive human anti-pig antibodies by absorption on recombinant mucin-containing glycoproteins carrying the Gal alpha1,3Gal epitope.

    ID: 1821958

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 9197365;

  54. Expression of alpha-1,3-galactose and other type 2 oligosaccharide structures in a porcine endothelial cell line transfected with human alpha-1,2-fuco...

    ID: 1821963

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc host organism:Homo sapiens

    Publication: 9287311;

  55. Two novel isoneolacto-undecaglycosylceramides carrying Galalpha1-->3Lewis(x) on the 6-linked antenna and N-acetylneuraminic acidalpha2-->3 or Galactos...

    ID: 1821974

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-[alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)]-beta-D-Gal-...

    Publication: 10211706;

  56. Two novel isoneolacto-undecaglycosylceramides carrying Galalpha1-->3Lewis(x) on the 6-linked antenna and N-acetylneuraminic acidalpha2-->3 or Galactos...

    ID: 1821976

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Gallus gallus

    Publication: 10211706;

  57. Delineation of antigen contact residues on an MHC class II molecule.

    ID: 1822063

    Description: epitope description:E98, K102 antigen name:H-2 class II histocompatibility antigen, A-K alpha chain host organism:Mus musculus BALB/c antibody name:H1...

    Publication: 2265605;

  58. Use of RhD fusion protein expressed on K562 cell surface in the study of molecular basis for D antigenic epitopes.

    ID: 1822256

    Description: epitope description:DTVGA antigen name:Blood group Rh(D) polypeptide host organism:Homo sapiens antibody name:LOR15C9

    Publication: 10026193;

  59. Immunochemical studies on a Mycoplasma pneumoniae polysaccharide fraction: cross-reactions with type 23 and 32 antipneumococcal rabbit sera.

    ID: 1822290

    Description: epitope description:alpha-L-rhamnopyranose antigen name:polysaccharide host organism:Oryctolagus cuniculus

    Publication: 27459;

  60. Structural determination and immunochemical characterization of the type V group B Streptococcus capsular polysaccharide.

    ID: 1822297

    Description: epitope description:{4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Glcp-(1->4)-[beta-D-Glcp-(1->3)]-beta-D-Galp-(1->4)-bet...

    Publication: 2016287;

  61. Isotype and antibody specificity of spontaneously formed immunoglobulins in pig fetuses and germ-free piglets: production by CD5- B cells.

    ID: 1822314

    Description: epitope description:2,4,6-trinitrophenyl group host organism:Sus scrofa Miniature Minnesota

    Publication: 8881765;

  62. HPA-1a phenotype-genotype discrepancy reveals a naturally occurring Arg93Gln substitution in the platelet beta 3 integrin that disrupts the HPA-1a epi...

    ID: 1822565

    Description: epitope description:L48 antigen name:Immunoglobulin host organism:Homo sapiens antibody name:CAMTRAN-007

    Publication: 11861302;

  63. Therapeutic antibody targeting of individual Notch receptors.

    ID: 1822585

    Description: epitope description:V1462, C1463, S1464, L1465, Q1466, N1468, W1497, K1498, Y1499, F1500, S1501, D1502, H1504, D1506, A1707, S1708, L1709, G1710, N171...

    Publication: 20393564;

  64. Analysis of the expression of H, Lewis, X, Y and precursor blood group determinants in saliva and red cells using a panel of mouse monoclonal antibodi...

    ID: 1822613

    Description: epitope description:beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcpNAc antigen name:glycoprotein host organism:Mus musculus antibody name:T-174

    Publication: 6083446;

  65. Analysis of the expression of H, Lewis, X, Y and precursor blood group determinants in saliva and red cells using a panel of mouse monoclonal antibodi...

    ID: 1822616

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcNAc antigen name:glycoprotein host organism:Mus musculus antibod...

    Publication: 6083446;

  66. Analysis of the expression of H, Lewis, X, Y and precursor blood group determinants in saliva and red cells using a panel of mouse monoclonal antibodi...

    ID: 1822617

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc antigen name:glycoprotein host organism:Mus musculus antibody name:P-12

    Publication: 6083446;

  67. Analysis of the expression of H, Lewis, X, Y and precursor blood group determinants in saliva and red cells using a panel of mouse monoclonal antibodi...

    ID: 1822618

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc antigen name:glycoprotein host organism:Mus musculus C57BL/...

    Publication: 6083446;

  68. High-affinity rabbit monoclonal antibodies specific for amyloid peptides amyloid-beta40 and amyloid-beta42.

    ID: 1819463

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 21116049;

  69. Retinoblastoma-independent antiproliferative activity of novel intracellular antibodies against the E7 oncoprotein in HPV 16-positive cells.

    ID: 1819484

    Description: epitope description:EYMLDLQPETTD antigen name:Protein E7 host organism:Homo sapiens antibody name:43M2 and 51

    Publication: 21241471;

  70. Retinoblastoma-independent antiproliferative activity of novel intracellular antibodies against the E7 oncoprotein in HPV 16-positive cells.

    ID: 1819485

    Description: epitope description:LDLQPETTDLYC antigen name:Protein E7 host organism:Homo sapiens antibody name:43M2 and 51

    Publication: 21241471;

  71. Retinoblastoma-independent antiproliferative activity of novel intracellular antibodies against the E7 oncoprotein in HPV 16-positive cells.

    ID: 1819492

    Description: epitope description:EEDEIDGPAGQA antigen name:Protein E7 host organism:Homo sapiens antibody name:43M2 and 51

    Publication: 21241471;

  72. Retinoblastoma-independent antiproliferative activity of novel intracellular antibodies against the E7 oncoprotein in HPV 16-positive cells.

    ID: 1819494

    Description: epitope description:GPAGQAEPDRAH antigen name:Protein E7 host organism:Homo sapiens antibody name:43M2 and 51

    Publication: 21241471;

  73. Lower motor neuron syndromes defined by patterns of weakness, nerve conduction abnormalities, and high titers of antiglycolipid antibodies.

    ID: 1819503

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 2327739;

  74. Lower motor neuron syndromes defined by patterns of weakness, nerve conduction abnormalities, and high titers of antiglycolipid antibodies.

    ID: 1819505

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 2327739;

  75. AIDP and CIDP having specific antibodies to the carbohydrate epitope (-NeuAcalpha2-8NeuAcalpha2-3Galbeta1-4Glc-) of gangliosides.

    ID: 1819597

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide host organism:Homo sapiens

    Publication: 15850580;

  76. AIDP and CIDP having specific antibodies to the carbohydrate epitope (-NeuAcalpha2-8NeuAcalpha2-3Galbeta1-4Glc-) of gangliosides.

    ID: 1819608

    Description: epitope description:ganglioside GM2 host organism:Homo sapiens

    Publication: 15850580;

  77. AIDP and CIDP having specific antibodies to the carbohydrate epitope (-NeuAcalpha2-8NeuAcalpha2-3Galbeta1-4Glc-) of gangliosides.

    ID: 1819609

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 15850580;

  78. AIDP and CIDP having specific antibodies to the carbohydrate epitope (-NeuAcalpha2-8NeuAcalpha2-3Galbeta1-4Glc-) of gangliosides.

    ID: 1819611

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 15850580;

  79. AIDP and CIDP having specific antibodies to the carbohydrate epitope (-NeuAcalpha2-8NeuAcalpha2-3Galbeta1-4Glc-) of gangliosides.

    ID: 1819614

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 15850580;

  80. AIDP and CIDP having specific antibodies to the carbohydrate epitope (-NeuAcalpha2-8NeuAcalpha2-3Galbeta1-4Glc-) of gangliosides.

    ID: 1819619

    Description: epitope description:N-acetyl-alpha-neuraminosyl-(2->3)-beta-D-galactosylceramide host organism:Homo sapiens

    Publication: 15850580;

  81. AIDP and CIDP having specific antibodies to the carbohydrate epitope (-NeuAcalpha2-8NeuAcalpha2-3Galbeta1-4Glc-) of gangliosides.

    ID: 1819623

    Description: epitope description:beta-D-GlcA3S-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 15850580;

  82. AIDP and CIDP having specific antibodies to the carbohydrate epitope (-NeuAcalpha2-8NeuAcalpha2-3Galbeta1-4Glc-) of gangliosides.

    ID: 1819629

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp host organism:...

    Publication: 15850580;

  83. AIDP and CIDP having specific antibodies to the carbohydrate epitope (-NeuAcalpha2-8NeuAcalpha2-3Galbeta1-4Glc-) of gangliosides.

    ID: 1819633

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 15850580;

  84. Ubiquitin chain editing revealed by polyubiquitin linkage-specific antibodies.

    ID: 1819646

    Description: epitope description:U: E18, P19, S20, T55, L56, S57, D58, N60, I61, Q62; V: T7, L8, T9, E34, G35, I36, P37, D39, Q40, L71, R72, L73, R74, G75 antigen ...

    Publication: 18724939;

  85. Ubiquitin chain editing revealed by polyubiquitin linkage-specific antibodies.

    ID: 1819650

    Description: epitope description:X: E18, P19, S20, T55, L56, S57, D58, N60, I61, Q62; Y: L8, T9, E34, G35, I36, P37, D39, Q40, L71, R72, L73, R74, G75, G76 antigen...

    Publication: 18724939;

  86. Ubiquitin chain editing revealed by polyubiquitin linkage-specific antibodies.

    ID: 1819651

    Description: epitope description:X: E18, P19, S20, T55, L56, S57, D58, N60, I61, Q62; Y: L8, T9, E34, G35, I36, P37, D39, Q40, L71, R72, L73, R74, G75, G76 antigen...

    Publication: 18724939;

  87. Ubiquitin chain editing revealed by polyubiquitin linkage-specific antibodies.

    ID: 1819661

    Description: epitope description:X: E18, P19, S20, T55, L56, S57, D58, N60, I61, Q62; Y: L8, T9, E34, G35, I36, P37, D39, Q40, L71, R72, L73, R74, G75, G76 antigen...

    Publication: 18724939;

  88. Anti-pig IgM antibodies in human serum react predominantly with Gal(alpha 1-3)Gal epitopes.

    ID: 1819666

    Description: epitope description:methyl alpha-D-glucopyranoside host organism:Homo sapiens

    Publication: 7504304;

  89. Epitope mapping of the indirect T cell response to allogeneic class I MHC: sequences shared by donor and recipient MHC may prime T cells that provide ...

    ID: 1819699

    Description: epitope description:ENPRMEPRARWMERE antigen name:RT1 class I histocompatibility antigen, AA alpha chain host organism:Rattus norvegicus PVG-RT1u

    Publication: 11591757;

  90. Epitope mapping of the indirect T cell response to allogeneic class I MHC: sequences shared by donor and recipient MHC may prime T cells that provide ...

    ID: 1819700

    Description: epitope description:WMEREGPEYWEQQTR antigen name:RT1 class I histocompatibility antigen, AA alpha chain host organism:Rattus norvegicus PVG-RT1u

    Publication: 11591757;

  91. Epitope mapping of the indirect T cell response to allogeneic class I MHC: sequences shared by donor and recipient MHC may prime T cells that provide ...

    ID: 1819709

    Description: epitope description:QITRNKWERARYAER antigen name:RT1 class I histocompatibility antigen, AA alpha chain host organism:Rattus norvegicus PVG-RT1u

    Publication: 11591757;

  92. Epitope mapping of the indirect T cell response to allogeneic class I MHC: sequences shared by donor and recipient MHC may prime T cells that provide ...

    ID: 1819735

    Description: epitope description:ENPRMEPRARWMERE antigen name:RT1 class I histocompatibility antigen, AA alpha chain host organism:Rattus norvegicus PVG-RT1u

    Publication: 11591757;

  93. Epitope mapping of the indirect T cell response to allogeneic class I MHC: sequences shared by donor and recipient MHC may prime T cells that provide ...

    ID: 1819738

    Description: epitope description:EQIYRVDLRTLRGYY antigen name:RT1 class I histocompatibility antigen, AA alpha chain host organism:Rattus norvegicus PVG-RT1u

    Publication: 11591757;

  94. Epitope mapping of the indirect T cell response to allogeneic class I MHC: sequences shared by donor and recipient MHC may prime T cells that provide ...

    ID: 1819740

    Description: epitope description:GSHTIQEMYGCDVGS antigen name:RT1 class I histocompatibility antigen, AA alpha chain host organism:Rattus norvegicus PVG-RT1u

    Publication: 11591757;

  95. Epitope mapping of the indirect T cell response to allogeneic class I MHC: sequences shared by donor and recipient MHC may prime T cells that provide ...

    ID: 1819742

    Description: epitope description:RGYRQDAYDGRDYIA antigen name:RT1 class I histocompatibility antigen, AA alpha chain host organism:Rattus norvegicus PVG-RT1u

    Publication: 11591757;

  96. High-affinity rabbit monoclonal antibodies specific for amyloid peptides amyloid-beta40 and amyloid-beta42.

    ID: 1819752

    Description: epitope description:GLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus New Zealand White antibody name:1-11-4

    Publication: 21116049;

  97. Cross-neutralization potential of native human papillomavirus N-terminal L2 epitopes.

    ID: 1819755

    Description: epitope description:GGLGIGTGSGTGGRTGYIPL antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus antibody name:anti-P56/75 #1

    Publication: 21346798;

  98. Cross-neutralization potential of native human papillomavirus N-terminal L2 epitopes.

    ID: 1819756

    Description: epitope description:GTGSGTGGRTGYIPL antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus antibody name:anti-P61/75 #2

    Publication: 21346798;

  99. Cross-neutralization potential of native human papillomavirus N-terminal L2 epitopes.

    ID: 1819758

    Description: epitope description:RPPLTVDPVGPSDPSIVSLVEE antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus antibody name:anti-P90/111 #1

    Publication: 21346798;

  100. Cross-neutralization potential of native human papillomavirus N-terminal L2 epitopes.

    ID: 1819760

    Description: epitope description:SLVEETSFIDAGAPTS antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus antibody name:anti-P107/122 #1

    Publication: 21346798;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston