A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

ID: 1472951

Description: epitope description:EQWPWSLLPIHY host organism:Oryctolagus cuniculus antibody name:anti-Gb3

A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

ID: 1472957

Description: epitope description:WHWTWLSEYPPP host organism:Oryctolagus cuniculus antibody name:anti-Gb3

Conjugates of synthetic cyclic peptides elicit bactericidal antibodies against a conformational epitope on a class 1 outer membrane protein of Neisser...

ID: 1472986

Description: epitope description:YTKDTNNNL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:Mouse sera

Characterization of monoclonal antibodies generated against Norwalk virus GII capsid protein expressed in Escherichia coli.

ID: 1472995

Description: epitope description:EAKVDTTAGRFTPKLGSLEISTESSDFDQNQPTRFTPVGIG antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:MAb 4D2

Analysis of the immune response against mixotope peptide libraries from a main antigenic site of foot-and-mouth disease virus.

ID: 1473011

Description: epitope description:TTYTASARGDLAHPTTTHARHL host organism:Cavia porcellus Duncan-Hartley antibody name:Guinea pig sera