Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Peptide microarray analysis of in silico-predicted epitopes for serological diagnosis of Toxoplasma gondii infection in humans.

    ID: 1942891

    Description: epitope description:DKKSTAAVILTPTENHFTL antigen name:Major surface antigen host organism:Homo sapiens

    Publication: 22496494;

  2. Peptide microarray analysis of in silico-predicted epitopes for serological diagnosis of Toxoplasma gondii infection in humans.

    ID: 1942905

    Description: epitope description:GGSPEKHHCTVKLEFAGAA antigen name:Major surface antigen host organism:Homo sapiens

    Publication: 22496494;

  3. Peptide microarray analysis of in silico-predicted epitopes for serological diagnosis of Toxoplasma gondii infection in humans.

    ID: 1942914

    Description: epitope description:PIEKFPVTTQTFVVGCIKG antigen name:Major surface antigen host organism:Homo sapiens

    Publication: 22496494;

  4. Peptide microarray analysis of in silico-predicted epitopes for serological diagnosis of Toxoplasma gondii infection in humans.

    ID: 1942915

    Description: epitope description:AGTTSSCTSKAVTLSSLIP antigen name:Major surface antigen host organism:Homo sapiens

    Publication: 22496494;

  5. Peptide microarray analysis of in silico-predicted epitopes for serological diagnosis of Toxoplasma gondii infection in humans.

    ID: 1942925

    Description: epitope description:NHFTLKCPKTALTEPPTLA antigen name:Major surface antigen host organism:Homo sapiens

    Publication: 22496494;

  6. Peptide microarray analysis of in silico-predicted epitopes for serological diagnosis of Toxoplasma gondii infection in humans.

    ID: 1942931

    Description: epitope description:SDPPLVANQVVTCPDKKS antigen name:Major surface antigen host organism:Homo sapiens

    Publication: 22496494;

  7. Molecular recognition of Candida albicans (1->2)-beta-mannan oligosaccharides by a protective monoclonal antibody reveals the immunodominance of inter...

    ID: 1942990

    Description: epitope description:4-deoxy-beta-D-mannopyranosyl-(1->2)-beta-D-mannopyranosyl-(1->2)-beta-D-mannopyranosyl group host organism:Mus musculus BALB/cByJ...

    Publication: 22493450;

  8. Molecular recognition of Candida albicans (1->2)-beta-mannan oligosaccharides by a protective monoclonal antibody reveals the immunodominance of inter...

    ID: 1942996

    Description: epitope description:beta-D-mannopyranosyl-(1->2)-beta-D-mannopyranosyl-(1->2)-4-deoxy-beta-D-mannopyranosyl group host organism:Mus musculus BALB/cByJ...

    Publication: 22493450;

  9. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943002

    Description: epitope description:S424, G523, P525, G530, D535, V538, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3A

    Publication: 22492964;

  10. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943003

    Description: epitope description:T416, N417, P484, Y485, V538, N540, G547, W549 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR1A

    Publication: 22492964;

  11. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943014

    Description: epitope description:R639, D698 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR4A

    Publication: 22492964;

  12. Early neutralizing IgG response to Chikungunya virus in infected patients targets a dominant linear epitope on the E2 glycoprotein.

    ID: 1943015

    Description: epitope description:STKDNFNVYK antigen name:Structural polyprotein host organism:Mus musculus C57BL/6

    Publication: 22389221;

  13. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943016

    Description: epitope description:R639, D698 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR4A, AR5A

    Publication: 22492964;

  14. Early neutralizing IgG response to Chikungunya virus in infected patients targets a dominant linear epitope on the E2 glycoprotein.

    ID: 1943017

    Description: epitope description:STKDNFNVYK antigen name:Structural polyprotein host organism:Mus musculus C57BL/6

    Publication: 22389221;

  15. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943027

    Description: epitope description:S424, G523, P525, G530, D535, V538, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3A

    Publication: 22492964;

  16. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943040

    Description: epitope description:S424, G523, P525, G530, D535, V538, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3A

    Publication: 22492964;

  17. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943044

    Description: epitope description:S424, G523, P525, G530, D535, V538, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3A

    Publication: 22492964;

  18. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943058

    Description: epitope description:R639, D698 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR4A, AR5A

    Publication: 22492964;

  19. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943130

    Description: epitope description:R639, D698 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR4A, AR5A

    Publication: 22492964;

  20. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943136

    Description: epitope description:S424, G523, P525, G530, D535, V538, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3A

    Publication: 22492964;

  21. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943137

    Description: epitope description:S424, G523, P525, G530, D535, V538, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3A

    Publication: 22492964;

  22. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943138

    Description: epitope description:S424, G523, P525, G530, D535, V538, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3A

    Publication: 22492964;

  23. Human broadly neutralizing antibodies to the envelope glycoprotein complex of hepatitis C virus.

    ID: 1943142

    Description: epitope description:R639, D698 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR4A, AR5A

    Publication: 22492964;

  24. Detection of human papillomavirus oncoprotein E7 in liquid-based cytology.

    ID: 1943147

    Description: epitope description:EIDGPAGQAEPDRAHYN antigen name:Protein E7 host organism:Mus musculus BALB/c antibody name:E7 16-1, E7 16-2, E7 16-9

    Publication: 22012460;

  25. Structural basis for broad detection of genogroup II noroviruses by a monoclonal antibody that binds to a site occluded in the viral particle.

    ID: 1943152

    Description: epitope description:V433, E496, N530, Y533, T534, L535 antigen name:Capsid protein VP1 host organism:Mus musculus antibody name:5B18

    Publication: 22278249;

  26. Structural basis for broad detection of genogroup II noroviruses by a monoclonal antibody that binds to a site occluded in the viral particle.

    ID: 1943153

    Description: epitope description:V433, E496, N530, Y533, T534, L535 antigen name:Capsid protein VP1 host organism:Mus musculus antibody name:5B18

    Publication: 22278249;

  27. The epitope and neutralization mechanism of AVFluIgG01, a broad-reactive human monoclonal antibody against H5N1 influenza virus.

    ID: 1943173

    Description: epitope description:I132, I133, P134, W138, S139, Y180, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:AVFluIgG01

    Publication: 22662275;

  28. The epitope and neutralization mechanism of AVFluIgG01, a broad-reactive human monoclonal antibody against H5N1 influenza virus.

    ID: 1943176

    Description: epitope description:I132, I133, P134, W138, S139, Y180, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:AVFluIgG01

    Publication: 22662275;

  29. The epitope and neutralization mechanism of AVFluIgG01, a broad-reactive human monoclonal antibody against H5N1 influenza virus.

    ID: 1943179

    Description: epitope description:YINPHMYWMSVA host organism:Homo sapiens antibody name:AVFluIgG01

    Publication: 22662275;

  30. The epitope and neutralization mechanism of AVFluIgG01, a broad-reactive human monoclonal antibody against H5N1 influenza virus.

    ID: 1943183

    Description: epitope description:ATYTTDAQSYHM host organism:Homo sapiens antibody name:AVFluIgG01

    Publication: 22662275;

  31. The epitope and neutralization mechanism of AVFluIgG01, a broad-reactive human monoclonal antibody against H5N1 influenza virus.

    ID: 1943196

    Description: epitope description:TFWVQTAKPNPL host organism:Homo sapiens antibody name:AVFluIgG01

    Publication: 22662275;

  32. The epitope and neutralization mechanism of AVFluIgG01, a broad-reactive human monoclonal antibody against H5N1 influenza virus.

    ID: 1943197

    Description: epitope description:TTNFLNHAIAHK host organism:Homo sapiens antibody name:AVFluIgG01

    Publication: 22662275;

  33. Walnut allergy in peanut-allergic patients: significance of sequential epitopes of walnut homologous to linear epitopes of Ara h 1, 2 and 3 in relatio...

    ID: 1943230

    Description: epitope description:VIDNLPEEVVANSYG antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 22042002;

  34. Antibodies to pathogenic epitopes on type XVII collagen cause skin fragility in a complement-dependent and -independent manner.

    ID: 1943238

    Description: epitope description:RRSILPYGDSMDRIEKDRLQ antigen name:Collagen alpha-1(XVII) chain host organism:Oryctolagus cuniculus

    Publication: 22523387;

  35. Walnut allergy in peanut-allergic patients: significance of sequential epitopes of walnut homologous to linear epitopes of Ara h 1, 2 and 3 in relatio...

    ID: 1943241

    Description: epitope description:SYSNQFGQFFEACPE antigen name:Jug r 2 host organism:Homo sapiens

    Publication: 22042002;

  36. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944213

    Description: epitope description:FPGFKEVR antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  37. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944215

    Description: epitope description:GFKEVRLV antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  38. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944224

    Description: epitope description:GRHDIAFV antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  39. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944226

    Description: epitope description:HDIAFVEF antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  40. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944227

    Description: epitope description:DIAFVEFD antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  41. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944228

    Description: epitope description:IAFVEFDN antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  42. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944454

    Description: epitope description:alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Mus musculus

    Publication: 17558551;

  43. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944463

    Description: epitope description:alpha-tyvelopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Homo sapiens

    Publication: 17558551;

  44. Detection of human papillomavirus oncoprotein E7 in liquid-based cytology.

    ID: 1944677

    Description: epitope description:EPDRAHYN antigen name:Protein E7 host organism:Mus musculus BALB/c antibody name:E7 (16-74)

    Publication: 22012460;

  45. Detection of human papillomavirus oncoprotein E7 in liquid-based cytology.

    ID: 1944678

    Description: epitope description:IVLHLEPQNEIPVDLLCHEQLSDSE antigen name:Protein E7 host organism:Mus musculus BALB/c antibody name:E7 (18-27) and E7(18-79)

    Publication: 22012460;

  46. Detection of human papillomavirus oncoprotein E7 in liquid-based cytology.

    ID: 1944679

    Description: epitope description:EEENDEIDGVNHQHLPARRAEPQRHTMLCM antigen name:Protein E7 host organism:Mus musculus BALB/c antibody name:E7(18-38) and E7(18-68)

    Publication: 22012460;

  47. Detection of human papillomavirus oncoprotein E7 in liquid-based cytology.

    ID: 1944689

    Description: epitope description:IVLHLEPQNEIPVDLLCHEQLSDSE antigen name:Protein E7 host organism:Mus musculus BALB/c antibody name:E7(18-27) and E7(18-79)

    Publication: 22012460;

  48. Mutation analysis of the cross-reactive epitopes of Japanese encephalitis virus envelope glycoprotein.

    ID: 1944753

    Description: epitope description:W101, G104, G106, L107, K312, A315, S331, G333, D389 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody na...

    Publication: 22337639;

  49. Self-assembled peptide nanofibers raising durable antibody responses against a malaria epitope.

    ID: 1944755

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

    Publication: 22695068;

  50. Self-assembled peptide nanofibers raising durable antibody responses against a malaria epitope.

    ID: 1944756

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c

    Publication: 22695068;

  51. Self-assembled peptide nanofibers raising durable antibody responses against a malaria epitope.

    ID: 1944757

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

    Publication: 22695068;

  52. Self-assembled peptide nanofibers raising durable antibody responses against a malaria epitope.

    ID: 1944760

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

    Publication: 22695068;

  53. Rabbit serum against K1 peptide, an immunogenic epitope of the Trypanosoma cruzi KMP-11, decreases parasite invasion to cells.

    ID: 1944828

    Description: epitope description:TLEEFSAKL antigen name:Other Trypanosoma cruzi protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22687575;

  54. Mapping of B cell epitopes on desmoglein 3 in pemphigus vulgaris patients by the use of overlapping peptides.

    ID: 1944835

    Description: epitope description:KALDYEQLQSVKLSIAVKNKAEFHQSVISRYRV antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 22261006;

  55. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944240

    Description: epitope description:GAARDSLQ antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  56. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944248

    Description: epitope description:GFKITQNN antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  57. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944250

    Description: epitope description:KITQNNAM antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  58. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944257

    Description: epitope description:MKISFAKK antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  59. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944325

    Description: epitope description:alpha-D-galactose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  60. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944345

    Description: epitope description:alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  61. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944346

    Description: epitope description:alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  62. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944351

    Description: epitope description:alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  63. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944352

    Description: epitope description:alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  64. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944353

    Description: epitope description:alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  65. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944354

    Description: epitope description:alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  66. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944358

    Description: epitope description:alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  67. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944365

    Description: epitope description:alpha-Tyvp-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus c...

    Publication: 17558551;

  68. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944369

    Description: epitope description:alpha-Tyvp-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus c...

    Publication: 17558551;

  69. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944377

    Description: epitope description:alpha-tyvelopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  70. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944379

    Description: epitope description:alpha-tyvelopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  71. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944383

    Description: epitope description:alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-...

    Publication: 17558551;

  72. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944390

    Description: epitope description:alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-...

    Publication: 17558551;

  73. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944397

    Description: epitope description:alpha-Parp-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus c...

    Publication: 17558551;

  74. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944400

    Description: epitope description:alpha-Parp-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus c...

    Publication: 17558551;

  75. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944404

    Description: epitope description:alpha-paratopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  76. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944409

    Description: epitope description:alpha-paratopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  77. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944411

    Description: epitope description:3-O-alpha-abequopyranosyl-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  78. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944423

    Description: epitope description:[3)-alpha-D-Galp-(1->2)-[alpha-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->]3 antigen name:lipopolysaccharide host organism:...

    Publication: 17558551;

  79. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944426

    Description: epitope description:[3)-alpha-D-Galp-(1->2)-[alpha-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->]3 antigen name:lipopolysaccharide host organism:...

    Publication: 17558551;

  80. Mapping of B cell epitopes on desmoglein 3 in pemphigus vulgaris patients by the use of overlapping peptides.

    ID: 1944847

    Description: epitope description:DGGYLMIDSKTAEIKFVKNMNR antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 22261006;

  81. Mapping of B cell epitopes on desmoglein 3 in pemphigus vulgaris patients by the use of overlapping peptides.

    ID: 1944848

    Description: epitope description:DGGYLMIDSKTAEIKFVKNMNR antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 22261006;

  82. Structural basis of the interaction of a Trypanosoma cruzi surface molecule implicated in oral infection with host cells and gastric mucin.

    ID: 1944853

    Description: epitope description:RANDKGSVISLARLTEELKT antigen name:Trans-sialidase, putative (UniProt:K4DRA4) host organism:Mus musculus BALB/c antibody name:3F6

    Publication: 22860068;

  83. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944966

    Description: epitope description:alpha-D-Glc-(1->2)-alpha-D-Glc-(1->3')-1,2-diacylglycerol host organism:Oryctolagus cuniculus Japanese white

    Publication: 22638862;

  84. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944987

    Description: epitope description:N-acetyl-beta-D-galactosaminyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide host organism:Oryctolagus cuniculus Japanes...

    Publication: 22638862;

  85. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944988

    Description: epitope description:N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide host organism:Ory...

    Publication: 22638862;

  86. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944993

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Oryctolagus cuniculus Japanese whit...

    Publication: 22638862;

  87. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944994

    Description: epitope description:N-acetyl-alpha-D-galactosaminyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-be...

    Publication: 22638862;

  88. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944995

    Description: epitope description:N-acetyl-alpha-D-galactosaminyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-be...

    Publication: 22638862;

  89. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1945001

    Description: epitope description:alpha-D-Gal-(1->2)-alpha-D-Glc-(1->3')-1,2-diacylglycerol host organism:Homo sapiens

    Publication: 22638862;

  90. Identification of conformational epitopes and antigen-specific residues at the D/A domains and the extramembrane C-terminal region of E2 glycoprotein ...

    ID: 1945009

    Description: epitope description:E635 antigen name:Genome polyprotein host organism:Mus musculus antibody name:T6, T11

    Publication: 22727685;

  91. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945025

    Description: epitope description:LVFFAEDVGSNKGAIIGAMVGGVV host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  92. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945028

    Description: epitope description:LVFFAEDVGSNKGAIIGLMVGGAV host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  93. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945029

    Description: epitope description:LVFFAEDVGSNKGAIIGLMVGGAV host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  94. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945034

    Description: epitope description:AIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  95. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945036

    Description: epitope description:AIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  96. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945040

    Description: epitope description:AIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  97. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945041

    Description: epitope description:AIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  98. Disease-associated polyglutamine stretches in monomeric huntingtin adopt a compact structure.

    ID: 1945051

    Description: epitope description:QQQQQQQQQQQQQQQQQQQQQQQQQ antigen name:Nuclear receptor coactivator 6 host organism:Mus musculus antibody name:3B5H10

    Publication: 22306738;

  99. Epitope reactions can be gauged by relative antibody discriminating specificity (RADS) values supported by deletion, substitution and cysteine bridge ...

    ID: 1945323

    Description: epitope description:VHTWTEQYK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H7.4, 1C6.3, 1G5.4-A1-C3

    Publication: 22546090;

  100. Epitope reactions can be gauged by relative antibody discriminating specificity (RADS) values supported by deletion, substitution and cysteine bridge ...

    ID: 1945325

    Description: epitope description:YSWKTWGKA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4

    Publication: 22546090;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston