Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945382

    Description: epitope description:GCPDNGMSEEARQ antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  2. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945517

    Description: epitope description:FKHSQPNQRKGLG antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  3. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945387

    Description: epitope description:PDNGMSEEARQKF antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  4. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945388

    Description: epitope description:PDNGMSEEARQKF antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  5. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945395

    Description: epitope description:MSEEARQKFLELH antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  6. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945398

    Description: epitope description:EEARQKFLELHNS antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  7. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945399

    Description: epitope description:EEARQKFLELHNS antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  8. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945402

    Description: epitope description:ARQKFLELHNSLR antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  9. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945403

    Description: epitope description:ARQKFLELHNSLR antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  10. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945405

    Description: epitope description:ARQKFLELHNSLR antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  11. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945407

    Description: epitope description:QKFLELHNSLRSS antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  12. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945411

    Description: epitope description:FLELHNSLRSSVA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  13. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945412

    Description: epitope description:FLELHNSLRSSVA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  14. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945420

    Description: epitope description:HNSLRSSVALGQA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  15. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945421

    Description: epitope description:HNSLRSSVALGQA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  16. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945424

    Description: epitope description:SLRSSVALGQAKD antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  17. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945427

    Description: epitope description:RSSVALGQAKDGA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  18. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945430

    Description: epitope description:SVALGQAKDGAGG antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  19. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945434

    Description: epitope description:ALGQAKDGAGGNA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  20. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945442

    Description: epitope description:AKDGAGGNAPKAA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  21. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945444

    Description: epitope description:AKDGAGGNAPKAA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  22. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945447

    Description: epitope description:DGAGGNAPKAAKM antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  23. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945458

    Description: epitope description:APKAAKMKTMAYD antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  24. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945463

    Description: epitope description:KAAKMKTMAYDCE antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  25. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945466

    Description: epitope description:AKMKTMAYDCEVE antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  26. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945470

    Description: epitope description:MKTMAYDCEVEKT antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  27. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945473

    Description: epitope description:MKTMAYDCEVEKT antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  28. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945479

    Description: epitope description:AYDCEVEKTAMNN antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  29. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945491

    Description: epitope description:EKTAMNNAKQCVF antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  30. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945496

    Description: epitope description:TAMNNAKQCVFKH antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  31. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945504

    Description: epitope description:NAKQCVFKHSQPN antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  32. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945506

    Description: epitope description:KQCVFKHSQPNQR antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  33. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945528

    Description: epitope description:NQRKGLGENIFMS antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  34. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945532

    Description: epitope description:RKGLGENIFMSSD antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  35. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945539

    Description: epitope description:GENIFMSSDSGMD antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  36. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945547

    Description: epitope description:FMSSDSGMDKAKA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  37. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945550

    Description: epitope description:SSDSGMDKAKAAE antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  38. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945553

    Description: epitope description:SSDSGMDKAKAAE antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  39. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945556

    Description: epitope description:DSGMDKAKAAEQA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  40. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945557

    Description: epitope description:DSGMDKAKAAEQA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  41. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945559

    Description: epitope description:GMDKAKAAEQASK antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  42. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945571

    Description: epitope description:AAEQASKAWFGEL antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  43. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945584

    Description: epitope description:KAWFGELAEKGVG antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  44. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945586

    Description: epitope description:WFGELAEKGVGQN antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  45. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945605

    Description: epitope description:GVGQNLKLTGGLF antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  46. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945617

    Description: epitope description:KLTGGLFSRGVGH antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  47. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945620

    Description: epitope description:TGGLFSRGVGHYT antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  48. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945632

    Description: epitope description:RGVGHYTQMVWQE antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  49. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945635

    Description: epitope description:VGHYTQMVWQETV antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  50. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945639

    Description: epitope description:HYTQMVWQETVKL antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  51. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945643

    Description: epitope description:TQMVWQETVKLGC antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  52. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945644

    Description: epitope description:TQMVWQETVKLGC antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  53. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945648

    Description: epitope description:MVWQETVKLGCYV antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  54. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945649

    Description: epitope description:MVWQETVKLGCYV antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  55. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945650

    Description: epitope description:WQETVKLGCYVEA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  56. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945657

    Description: epitope description:ETVKLGCYVEACS antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  57. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945664

    Description: epitope description:LGCYVEACSNMCY antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  58. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945666

    Description: epitope description:CYVEACSNMCYVV antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  59. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945675

    Description: epitope description:ACSNMCYVVCQYG antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  60. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945677

    Description: epitope description:ACSNMCYVVCQYG antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  61. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945680

    Description: epitope description:SNMCYVVCQYGPA antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  62. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945686

    Description: epitope description:YVVCQYGPAGNMM antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  63. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945695

    Description: epitope description:QYGPAGNMMGKDI antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  64. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945697

    Description: epitope description:QYGPAGNMMGKDI antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  65. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945698

    Description: epitope description:GPAGNMMGKDIYE antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  66. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945700

    Description: epitope description:GPAGNMMGKDIYE antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  67. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945711

    Description: epitope description:MGKDIYEKGEPCS antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  68. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945728

    Description: epitope description:GEPCSKCENCDKE antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  69. Generalized urticaria induced by the Na-ASP-2 hookworm vaccine: implications for the development of vaccines against helminths.

    ID: 1945732

    Description: epitope description:PCSKCENCDKEKG antigen name:SCP-like protein host organism:Homo sapiens

    Publication: 22633322;

  70. Epitope reactions can be gauged by relative antibody discriminating specificity (RADS) values supported by deletion, substitution and cysteine bridge ...

    ID: 1945746

    Description: epitope description:YSWKTWGKA antigen name:Genome polyprotein host organism:Mus musculus B10.S

    Publication: 22546090;

  71. Epitope reactions can be gauged by relative antibody discriminating specificity (RADS) values supported by deletion, substitution and cysteine bridge ...

    ID: 1945748

    Description: epitope description:TTASGKLIT antigen name:Genome polyprotein host organism:Mus musculus B10.S

    Publication: 22546090;

  72. Development of a novel immunoassay for the measurement of type II collagen neoepitope generated by collagenase cleavage.

    ID: 1945914

    Description: epitope description:GPPGPQG + HYL(P3) antigen name:Collagen alpha-1(II) chain host organism:Mus musculus A/J antibody name:20A10

    Publication: 22507082;

  73. Mapping of antigenic determinants on a SAT2 foot-and-mouth disease virus using chicken single-chain antibody fragments.

    ID: 1945918

    Description: epitope description:KYTQQSTAIRGDRAVLAAKYANTKRKLPSTFNFGYVTADK antigen name:Polyprotein host organism:Gallus gallus antibody name:scFv2

    Publication: 22698877;

  74. Human monoclonal antibodies to a novel cluster of conformational epitopes on HCV E2 with resistance to neutralization escape in a genotype 2a isolate.

    ID: 1945919

    Description: epitope description:L441, F442, Y443, Y613, W616 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HC-84.20

    Publication: 22511875;

  75. Human monoclonal antibodies to a novel cluster of conformational epitopes on HCV E2 with resistance to neutralization escape in a genotype 2a isolate.

    ID: 1945928

    Description: epitope description:L441, F442, Y443 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HC-84.21

    Publication: 22511875;

  76. Human monoclonal antibodies to a novel cluster of conformational epitopes on HCV E2 with resistance to neutralization escape in a genotype 2a isolate.

    ID: 1945931

    Description: epitope description:L441, F442, Y443 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HC-84.21

    Publication: 22511875;

  77. Human monoclonal antibodies to a novel cluster of conformational epitopes on HCV E2 with resistance to neutralization escape in a genotype 2a isolate.

    ID: 1945932

    Description: epitope description:L441, F442, Y443 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HC-84.21

    Publication: 22511875;

  78. Walnut allergy in peanut-allergic patients: significance of sequential epitopes of walnut homologous to linear epitopes of Ara h 1, 2 and 3 in relatio...

    ID: 1943252

    Description: epitope description:VIDNLPEEVVANSYG antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 22042002;

  79. Walnut allergy in peanut-allergic patients: significance of sequential epitopes of walnut homologous to linear epitopes of Ara h 1, 2 and 3 in relatio...

    ID: 1943256

    Description: epitope description:VFSGFDADFLADAFN antigen name:Jug r 4 host organism:Homo sapiens

    Publication: 22042002;

  80. Antigenic characteristics of the complete and truncated capsid protein VP1 of enterovirus 71.

    ID: 1943267

    Description: epitope description:GEIDLPLEGTTNPNG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22659489;

  81. Antigenic characteristics of the complete and truncated capsid protein VP1 of enterovirus 71.

    ID: 1943269

    Description: epitope description:GEIDLPLEGTTNPNG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 22659489;

  82. Antigenic characteristics of the complete and truncated capsid protein VP1 of enterovirus 71.

    ID: 1943275

    Description: epitope description:LEGTTNPNGYANWDI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22659489;

  83. Epitope mapping of a monoclonal antibody against the Gp85 of avian leukosis virus subgroup J.

    ID: 1943280

    Description: epitope description:LPWDPQELDILG antigen name:envelope protein host organism:Mus musculus BALB/c antibody name:1E3

    Publication: 22214862;

  84. Structural characterization of Schistosoma mansoni adult worm glycosphingolipids reveals pronounced differences with those of cercariae.

    ID: 1943282

    Description: epitope description:beta-D-GalpNAc-(1->4)-D-GlcpNAc antigen name:glycosphingolipid host organism:Mus musculus antibody name:259-2A1

    Publication: 22241826;

  85. Structural and biochemical characterization of the vaccinia virus envelope protein D8 and its recognition by the antibody LA5.

    ID: 1943428

    Description: epitope description:Q3, L5, T39, G40, K41, R44, K108, N145, I174, N175, H176, S177, S204, L205, I215, E217, Y219, R220, N221, Y223, K224 antigen name:...

    Publication: 22623786;

  86. Serum antibody screening by surface plasmon resonance using a natural glycan microarray.

    ID: 1943465

    Description: epitope description:alpha-L-Fuc-(1->3)-beta-D-GalNAc-(1->4)-beta-D-GlcNAc-yl group antigen name:glycoprotein host organism:Homo sapiens

    Publication: 18193481;

  87. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944070

    Description: epitope description:KTDSDIIA antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  88. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944072

    Description: epitope description:DSDIIAKM antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  89. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944075

    Description: epitope description:IIAKMKGT antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  90. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944078

    Description: epitope description:KMKGTFVE antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  91. Serum antibody screening by surface plasmon resonance using a natural glycan microarray.

    ID: 1943466

    Description: epitope description:alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)-beta-D-GlcpNAc antigen name:glycoprotein host organism:Homo sapiens

    Publication: 18193481;

  92. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1943472

    Description: epitope description:alpha-D-galactose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  93. Selective blockade of trypanosomatid protein synthesis by a recombinant antibody anti-Trypanosoma cruzi P2beta protein.

    ID: 1943538

    Description: epitope description:EEEDDDDDFGMGALF antigen name:60S acidic ribosomal protein P0 host organism:Mus musculus BALB/c antibody name:scFv C5

    Publication: 22570698;

  94. Selective blockade of trypanosomatid protein synthesis by a recombinant antibody anti-Trypanosoma cruzi P2beta protein.

    ID: 1943688

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus BALB/c antibody name:scFv C5

    Publication: 22570698;

  95. Selective blockade of trypanosomatid protein synthesis by a recombinant antibody anti-Trypanosoma cruzi P2beta protein.

    ID: 1943692

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus BALB/c antibody name:scFv C5

    Publication: 22570698;

  96. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1943800

    Description: epitope description:RKREKRKP antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  97. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1943801

    Description: epitope description:KREKRKPK antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  98. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1943970

    Description: epitope description:LVSRSLKMRGQAF antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  99. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1943976

    Description: epitope description:LVSRSLKMRGQAF antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  100. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1943980

    Description: epitope description:LVSRSLKMRGQAF antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston