Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Antibodies that neutralize human beta interferon biologic activity recognize a linear epitope: analysis by synthetic peptide mapping.

    ID: 1838866

    Description: epitope description:NFDIPEEI antigen name:Interferon beta host organism:Oryctolagus cuniculus

    Publication: 1708891;

  2. Antibodies that neutralize human beta interferon biologic activity recognize a linear epitope: analysis by synthetic peptide mapping.

    ID: 1838869

    Description: epitope description:EEIKQLQQ antigen name:Interferon beta host organism:Oryctolagus cuniculus

    Publication: 1708891;

  3. Antibodies that neutralize human beta interferon biologic activity recognize a linear epitope: analysis by synthetic peptide mapping.

    ID: 1838877

    Description: epitope description:IPEEIKQL antigen name:Interferon beta host organism:Oryctolagus cuniculus

    Publication: 1708891;

  4. A novel peptide ELISA for universal detection of antibodies to human H5N1 influenza viruses.

    ID: 1838884

    Description: epitope description:CNTKCQTPMGAINSS antigen name:Hemagglutinin host organism:Homo sapiens

    Publication: 21695200;

  5. A novel peptide ELISA for universal detection of antibodies to human H5N1 influenza viruses.

    ID: 1838887

    Description: epitope description:CNTKCQTP antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:5F8

    Publication: 21695200;

  6. Antibodies that neutralize human beta interferon biologic activity recognize a linear epitope: analysis by synthetic peptide mapping.

    ID: 1838895

    Description: epitope description:LKDRMNFDIPEEIKQL antigen name:Interferon beta host organism:Oryctolagus cuniculus

    Publication: 1708891;

  7. Identification of epitopes within beta lactoglobulin recognised by polyclonal antibodies using phage display and PEPSCAN.

    ID: 1838901

    Description: epitope description:SDIDLLSQV host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9671121;

  8. Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine desi...

    ID: 1838980

    Description: epitope description:ELEKWAS antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 19740978;

  9. Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine desi...

    ID: 1838982

    Description: epitope description:ALDKWQN antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 19740978;

  10. Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine desi...

    ID: 1838984

    Description: epitope description:ELDKWNSL antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 19740978;

  11. Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine desi...

    ID: 1838987

    Description: epitope description:ELDKWAG antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 19740978;

  12. Neutralizing monoclonal antibodies against hepatitis C virus E2 protein bind discontinuous epitopes and inhibit infection at a postattachment step.

    ID: 1838996

    Description: epitope description:W529, G530 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:H77.27

    Publication: 21543495;

  13. Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine desi...

    ID: 1839002

    Description: epitope description:ELDKWAS antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 19740978;

  14. The monoclonal antibody TAL16.1 recognizes the aspartic acid residue at position 70 in DRB gene products.

    ID: 1839005

    Description: epitope description:D99 antigen name:HLA class II histocompatibility antigen, DRB1-4 beta chain host organism:Mus musculus C3H antibody name:TAL16.1

    Publication: 7681224;

  15. Neutralizing monoclonal antibodies against hepatitis C virus E2 protein bind discontinuous epitopes and inhibit infection at a postattachment step.

    ID: 1839009

    Description: epitope description:W529, G530, D533 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:H77.31

    Publication: 21543495;

  16. Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine desi...

    ID: 1839010

    Description: epitope description:ELDKWAS antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 19740978;

  17. Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine desi...

    ID: 1839011

    Description: epitope description:ELDKWAS antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 19740978;

  18. Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine desi...

    ID: 1839014

    Description: epitope description:ELDKWAS antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 19740978;

  19. Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine desi...

    ID: 1839016

    Description: epitope description:ELDKWAS antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 19740978;

  20. Neutralizing monoclonal antibodies against hepatitis C virus E2 protein bind discontinuous epitopes and inhibit infection at a postattachment step.

    ID: 1839030

    Description: epitope description:W529, G530 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:H77.36

    Publication: 21543495;

  21. Neutralizing monoclonal antibodies against hepatitis C virus E2 protein bind discontinuous epitopes and inhibit infection at a postattachment step.

    ID: 1839033

    Description: epitope description:W529, G530 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:H77.36

    Publication: 21543495;

  22. Neutralizing monoclonal antibodies against hepatitis C virus E2 protein bind discontinuous epitopes and inhibit infection at a postattachment step.

    ID: 1839050

    Description: epitope description:A526, W531 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:J6.27

    Publication: 21543495;

  23. Neutralizing monoclonal antibodies against hepatitis C virus E2 protein bind discontinuous epitopes and inhibit infection at a postattachment step.

    ID: 1839065

    Description: epitope description:G406, G397, R574 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:J6.36

    Publication: 21543495;

  24. Neutralizing monoclonal antibodies against hepatitis C virus E2 protein bind discontinuous epitopes and inhibit infection at a postattachment step.

    ID: 1839067

    Description: epitope description:G406, G397, R574 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:J6.36

    Publication: 21543495;

  25. Structural basis for HIV-1 neutralization by a gp41 fusion intermediate-directed antibody.

    ID: 1840782

    Description: epitope description:I573, K574, Q577, R633, N636, S640, H643, H564, Q567, L568, T569, W571, G572, K574, Q575, L576, A578, R579 antigen name:Envelope g...

    Publication: 16862157;

  26. Structural basis for HIV-1 neutralization by a gp41 fusion intermediate-directed antibody.

    ID: 1840789

    Description: epitope description:I573, K574, Q577, R633, N636, S640, H643, H564, Q567, L568, T569, W571, G572, K574, Q575, L576, A578, R579 antigen name:Envelope g...

    Publication: 16862157;

  27. Antigenic regions of poliovirus type 3/Sabin capsid proteins recognized by human sera in the peptide scanning technique.

    ID: 1841535

    Description: epitope description:SEVAQGALTLSLPK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1701949;

  28. Antigenic regions of poliovirus type 3/Sabin capsid proteins recognized by human sera in the peptide scanning technique.

    ID: 1841542

    Description: epitope description:TYKDTVQLRRKLEF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1701949;

  29. B cell epitopes of gliadin.

    ID: 1841845

    Description: epitope description:PQQLPQ antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 10931138;

  30. B cell epitopes of gliadin.

    ID: 1841870

    Description: epitope description:QQQPFP antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 10931138;

  31. The unique solution structure and immunochemistry of the Candida albicans beta -1,2-mannopyranan cell wall antigens.

    ID: 1842006

    Description: epitope description:beta-D-mannopyranosyl-(1->2)-beta-D-mannopyranosyl group antigen name:mannan host organism:Mus musculus BALB/cByJ antibody name:C3...

    Publication: 11700318;

  32. The human natural anti-Gal IgG. III. The subtlety of immune tolerance in man as demonstrated by crossreactivity between natural anti-Gal and anti-B an...

    ID: 1842033

    Description: epitope description:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 2434599;

  33. Structure and mechanistic analysis of the anti-human immunodeficiency virus type 1 antibody 2F5 in complex with its gp41 epitope.

    ID: 1842042

    Description: epitope description:ELDKWAS antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 15367639;

  34. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842046

    Description: epitope description:MFPVGTPDPEYPD antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  35. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842050

    Description: epitope description:YVWNRTALLQAAD antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  36. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842052

    Description: epitope description:ALLQAADDSSVTH antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  37. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842056

    Description: epitope description:HLMGLFEPADMKY antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  38. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842063

    Description: epitope description:YNVQQDHTKDPTL antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  39. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842064

    Description: epitope description:QQDHTKDPTLQEM antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  40. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842065

    Description: epitope description:HTKDPTLQEMTEV antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  41. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842066

    Description: epitope description:DPTLQEMTEVALR antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  42. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842084

    Description: epitope description:ALTEAGMFDNAIA antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  43. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842087

    Description: epitope description:NAIAKANELTSEL antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  44. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842091

    Description: epitope description:RGFYLFVEGGRID antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  45. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842099

    Description: epitope description:LTEAGMFDNAIAK antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  46. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842103

    Description: epitope description:AIAKANELTSELD antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  47. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842105

    Description: epitope description:ELTSELDTLILVT antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  48. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842110

    Description: epitope description:RGPQAHLVHGVEE antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  49. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842115

    Description: epitope description:LVHGVEEETFVAH antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  50. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842119

    Description: epitope description:HIMAFAGCVEPYT antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  51. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1842120

    Description: epitope description:AFAGCVEPYTDCN antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  52. Epitope grafting, re-creating a conformational Bet v 1 antibody epitope on the surface of the homologous apple allergen Mal d 1.

    ID: 1842128

    Description: epitope description:E43, N44, I45, E46, G47, N48, G49, G50, P51, G52, T53, R71, D73, H77, I87, K98 antigen name:Bet v 1 host organism:Mus musculus BAL...

    Publication: 21454600;

  53. Antibody domain exchange is an immunological solution to carbohydrate cluster recognition.

    ID: 1842129

    Description: epitope description:alpha-D-Manp-(1->2)-alpha-D-Manp antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2G12

    Publication: 12829775;

  54. Direct visualization of peptide/MHC complexes at the surface and in the intracellular compartments of cells infected in vivo by Leishmania major.

    ID: 1842140

    Description: epitope description:FSPSLEHPIVVSGSWD antigen name:Activated protein kinase c receptor host organism:Mus musculus BALB/c LACK TCR Tg antibody name:2C44

    Publication: 20976202;

  55. Immunogenic comparison for two different recombinant chimeric peptides (CP12 and CP22) containing one or two copies of three linear B cell epitopes fr...

    ID: 1842143

    Description: epitope description:RLPPSDT antigen name:Choriogonadotropin subunit beta host organism:Mus musculus antibody name:OT3A

    Publication: 21084058;

  56. Double reactivity of monoclonal and polyclonal rheumatoid factors for IgG and histones: mapping of binding sites by means of histone synthetic peptide...

    ID: 1842171

    Description: epitope description:SETAPAAPAAPAPAEK antigen name:Histone H1.4 host organism:Homo sapiens antibody name:RF

    Publication: 1373058;

  57. Double reactivity of monoclonal and polyclonal rheumatoid factors for IgG and histones: mapping of binding sites by means of histone synthetic peptide...

    ID: 1842173

    Description: epitope description:KPKAAKPKKAAAKKK antigen name:Histone H1.4 host organism:Homo sapiens antibody name:RF

    Publication: 1373058;

  58. Double reactivity of monoclonal and polyclonal rheumatoid factors for IgG and histones: mapping of binding sites by means of histone synthetic peptide...

    ID: 1843062

    Description: epitope description:ARTKQTARKSTGGKAPRKQLA antigen name:Histone H3.1 host organism:Homo sapiens antibody name:RF

    Publication: 1373058;

  59. Double reactivity of monoclonal and polyclonal rheumatoid factors for IgG and histones: mapping of binding sites by means of histone synthetic peptide...

    ID: 1843063

    Description: epitope description:KQLATKAARKSAPAT antigen name:Histone H3.1 host organism:Homo sapiens antibody name:RF

    Publication: 1373058;

  60. Crystal structure of a soluble CD28-Fab complex.

    ID: 1843067

    Description: epitope description:E50, R52, V67, Y69, Q77, Y79, S80, K81, T82, G83, E115, M117, Y118, Y122 antigen name:T-cell-specific surface glycoprotein CD28 ho...

    Publication: 15696168;

  61. A novel peptide ELISA for universal detection of antibodies to human H5N1 influenza viruses.

    ID: 1843074

    Description: epitope description:CNTKCQTPMGAINSS antigen name:Hemagglutinin host organism:Gallus gallus Leghorn

    Publication: 21695200;

  62. A novel peptide ELISA for universal detection of antibodies to human H5N1 influenza viruses.

    ID: 1843078

    Description: epitope description:CNTKCQTPMGAINSS antigen name:Hemagglutinin host organism:Gallus gallus Leghorn

    Publication: 21695200;

  63. A novel peptide ELISA for universal detection of antibodies to human H5N1 influenza viruses.

    ID: 1843116

    Description: epitope description:CNTKCQTPMGAINSS antigen name:Hemagglutinin host organism:Gallus gallus Leghorn

    Publication: 21695200;

  64. A novel peptide ELISA for universal detection of antibodies to human H5N1 influenza viruses.

    ID: 1843125

    Description: epitope description:CNTKCQTPMGAINSS antigen name:Hemagglutinin host organism:Gallus gallus Leghorn

    Publication: 21695200;

  65. Double reactivity of monoclonal and polyclonal rheumatoid factors for IgG and histones: mapping of binding sites by means of histone synthetic peptide...

    ID: 1843153

    Description: epitope description:GEASRLAHYNKRSTITSR antigen name:Histone H2B type 1 host organism:Homo sapiens antibody name:RF

    Publication: 1373058;

  66. Double reactivity of monoclonal and polyclonal rheumatoid factors for IgG and histones: mapping of binding sites by means of histone synthetic peptide...

    ID: 1843179

    Description: epitope description:RYQKSTELLIRKLPFQRL antigen name:Histone H3.1 host organism:Homo sapiens antibody name:RF

    Publication: 1373058;

  67. Double reactivity of monoclonal and polyclonal rheumatoid factors for IgG and histones: mapping of binding sites by means of histone synthetic peptide...

    ID: 1843183

    Description: epitope description:AIHAKRVTIMPKDIQLARRI antigen name:Histone H3.1 host organism:Homo sapiens antibody name:RF

    Publication: 1373058;

  68. Double reactivity of monoclonal and polyclonal rheumatoid factors for IgG and histones: mapping of binding sites by means of histone synthetic peptide...

    ID: 1843184

    Description: epitope description:IRGERA antigen name:Histone H3.1 host organism:Homo sapiens antibody name:RF

    Publication: 1373058;

  69. Structure and antigenicity of the mannans of Candida famata and Candida saitoana: comparative study with the mannan of Candida guilliermondii.

    ID: 1843211

    Description: epitope description:beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-D-Manp host organism:Oryctolagus...

    Publication: 8951034;

  70. A novel ICOS-independent, but CD28- and SAP-dependent, pathway of T cell-dependent, polysaccharide-specific humoral immunity in response to intact Str...

    ID: 1843215

    Description: epitope description:phosphocholine antigen name:teichoic acid host organism:Mus musculus C57BL/6

    Publication: 19050242;

  71. Beta-galactofuranose-containing O-linked oligosaccharides present in the cell wall peptidogalactomannan of Aspergillus fumigatus contain immunodominan...

    ID: 1843221

    Description: epitope description:beta-D-Galf-(1->5)-beta-D-Galf-(1->6)-alpha-D-Manp-(1->6)-D-Manp antigen name:galactomannan host organism:Homo sapiens

    Publication: 12851285;

  72. B cell epitopes of gliadin.

    ID: 1843230

    Description: epitope description:FFQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 10931138;

  73. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843241

    Description: epitope description:AKRARRGKG antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  74. Epitope specificity of myeloperoxidase antibodies: identification of candidate human immunodominant epitopes.

    ID: 1834119

    Description: epitope description:WDGERLYQEA antigen name:Myeloperoxidase host organism:Homo sapiens

    Publication: 21401576;

  75. Epitope specificity of myeloperoxidase antibodies: identification of candidate human immunodominant epitopes.

    ID: 1834122

    Description: epitope description:IFMSNSYPRD antigen name:Myeloperoxidase host organism:Homo sapiens

    Publication: 21401576;

  76. Partial protection against classical swine fever virus elicited by dendrimeric vaccine-candidate peptides in domestic pigs.

    ID: 1834130

    Description: epitope description:AEGLTTTWKDYDHNLQ antigen name:Genome polyprotein host organism:Sus scrofa Landrace X Large White

    Publication: 21496472;

  77. Partial protection against classical swine fever virus elicited by dendrimeric vaccine-candidate peptides in domestic pigs.

    ID: 1834141

    Description: epitope description:AEGLTTTWKDYDHNLQ antigen name:Genome polyprotein host organism:Sus scrofa Landrace X Large White

    Publication: 21496472;

  78. Highly conserved region 141‒168 of the NS1 protein is a new common epitope region of dengue virus.

    ID: 1834189

    Description: epitope description:DSGCVVNWKGRELKCGSGIFVTNEVHTWTEQYKFQADSPK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5E2

    Publication: 21519123;

  79. Highly conserved region 141‒168 of the NS1 protein is a new common epitope region of dengue virus.

    ID: 1834193

    Description: epitope description:PECPDDQRAWNIWEVEDYGFGIFTTNIW antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5G12

    Publication: 21519123;

  80. Peptide reactivity between multiple sclerosis (MS) CSF IgG and recombinant antibodies generated from clonally expanded plasma cells in MS CSF.

    ID: 1834335

    Description: epitope description:SCNYHHTYLTCW host organism:Homo sapiens antibody name:02-19 rAb #25

    Publication: 21176973;

  81. Epitope fine specificity of human anti-HLA-A2 antibodies. Identification of four epitopes including a haptenlike epitope on HLA-A2 at lysine 127.

    ID: 1834336

    Description: epitope description:K151 antigen name:HLA class I histocompatibility antigen, A-2 alpha chain host organism:Homo sapiens antibody name:DOUV, L.C.

    Publication: 7503972;

  82. Peptide reactivity between multiple sclerosis (MS) CSF IgG and recombinant antibodies generated from clonally expanded plasma cells in MS CSF.

    ID: 1834338

    Description: epitope description:NCAFWLGKLYCR host organism:Homo sapiens antibody name:02-19 rAb #25

    Publication: 21176973;

  83. Peptide reactivity between multiple sclerosis (MS) CSF IgG and recombinant antibodies generated from clonally expanded plasma cells in MS CSF.

    ID: 1834346

    Description: epitope description:NALTESKYVKLL host organism:Homo sapiens antibody name:02-19 CSF IgG

    Publication: 21176973;

  84. Peptide reactivity between multiple sclerosis (MS) CSF IgG and recombinant antibodies generated from clonally expanded plasma cells in MS CSF.

    ID: 1834355

    Description: epitope description:HIDVSRPWRVTG host organism:Homo sapiens antibody name:03-7 CSF IgG

    Publication: 21176973;

  85. Peptide reactivity between multiple sclerosis (MS) CSF IgG and recombinant antibodies generated from clonally expanded plasma cells in MS CSF.

    ID: 1834359

    Description: epitope description:SVSVGMKPSPRP host organism:Homo sapiens antibody name:04-2 rAb #33

    Publication: 21176973;

  86. HLA-DR alpha chain residues located on the outer loops are involved in nonpolymorphic and polymorphic antibody-binding epitopes.

    ID: 1834424

    Description: epitope description:N28, Q31, S32, M49, A50 antigen name:HLA class II histocompatibility antigen, DR alpha chain host organism:Mus musculus antibody n...

    Publication: 7520896;

  87. HLA-DR alpha chain residues located on the outer loops are involved in nonpolymorphic and polymorphic antibody-binding epitopes.

    ID: 1834429

    Description: epitope description:Q31 antigen name:HLA class II histocompatibility antigen, DR alpha chain host organism:Mus musculus BALB/c antibody name:I-2

    Publication: 7520896;

  88. Characterization of the murine Th2 response to immunization with liposomal M2e influenza vaccine.

    ID: 1834430

    Description: epitope description:MSLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 21545821;

  89. Characterization of the murine Th2 response to immunization with liposomal M2e influenza vaccine.

    ID: 1834433

    Description: epitope description:MSLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 21545821;

  90. Characterization of the murine Th2 response to immunization with liposomal M2e influenza vaccine.

    ID: 1834435

    Description: epitope description:MSLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 21545821;

  91. Characterization of the murine Th2 response to immunization with liposomal M2e influenza vaccine.

    ID: 1834436

    Description: epitope description:MSLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 21545821;

  92. Characterization of the murine Th2 response to immunization with liposomal M2e influenza vaccine.

    ID: 1834443

    Description: epitope description:MSLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 21545821;

  93. N-Propionylated group B meningococcal polysaccharide mimics a unique bactericidal capsular epitope in group B Neisseria meningitidis.

    ID: 1834456

    Description: epitope description:[8)-alpha-Neu5Pr-(2->]5 host organism:Mus musculus BALB/c antibody name:6B9

    Publication: 9166422;

  94. A strategy for rational design of fully synthetic glycopeptide conjugate vaccines.

    ID: 1834464

    Description: epitope description:VKGYLAGYLAGKGVDAGKLGTVSYG antigen name:Outer membrane protein P6 host organism:Oryctolagus cuniculus

    Publication: 9393776;

  95. Targeted identification of a unique glycan epitope of Schistosoma mansoni egg antigens using a diagnostic antibody.

    ID: 1834468

    Description: epitope description:alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc antigen nam...

    Publication: 17188765;

  96. Improved removal of anti-A and anti-B antibodies from plasma using blood-group-active haptens.

    ID: 1835160

    Description: epitope description:alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal host organism:Homo sapiens

    Publication: 8212667;

  97. Design and characterization of epitope-scaffold immunogens that present the motavizumab epitope from respiratory syncytial virus.

    ID: 1835243

    Description: epitope description:NSELLSLINDMPITNDQKKLMSNN antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c antibody name:Motavizumab

    Publication: 21549714;

  98. Identification of the shortest Abeta-peptide generating highly specific antibodies against the C-terminal end of amyloid-beta42.

    ID: 1835246

    Description: epitope description:GGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus C57BL/6

    Publication: 21371581;

  99. Design and evaluation of a multi-epitope assembly peptide (MEAP) against herpes simplex virus type 2 infection in BALB/c mice.

    ID: 1835341

    Description: epitope description:DPPERPDSP antigen name:Envelope glycoprotein E host organism:Mus musculus Kunming

    Publication: 21575169;

  100. Design and evaluation of a multi-epitope assembly peptide (MEAP) against herpes simplex virus type 2 infection in BALB/c mice.

    ID: 1835343

    Description: epitope description:EPPDDDDS antigen name:Envelope glycoprotein G host organism:Mus musculus Kunming

    Publication: 21575169;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston