Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Novel antibody specificities targeting glycoprotein B of cytomegalovirus identified by molecular library technology.

    ID: 1678138

    Description: epitope description:ANETIYNTTLKYGDV antigen name:Envelope glycoprotein B host organism:Mus musculus C57BL/6

    Publication: 19464399;

  2. Novel antibody specificities targeting glycoprotein B of cytomegalovirus identified by molecular library technology.

    ID: 1678139

    Description: epitope description:ANETIYNTTLKYGDV antigen name:Envelope glycoprotein B host organism:Mus musculus C57BL/6 antibody name:gB-14

    Publication: 19464399;

  3. Drugs as allergens: the molecular basis of IgE binding to thiopentone.

    ID: 1678148

    Description: epitope description:thiopental host organism:Homo sapiens

    Publication: 3654008;

  4. Drugs as allergens: an immunoassay for detecting IgE antibodies to cephalosporins.

    ID: 1678183

    Description: epitope description:ampicillin host organism:Homo sapiens

    Publication: 2083978;

  5. Drugs as allergens: an immunoassay for detecting IgE antibodies to cephalosporins.

    ID: 1678187

    Description: epitope description:amoxicillin host organism:Homo sapiens

    Publication: 2083978;

  6. Drugs as allergens: an immunoassay for detecting IgE antibodies to cephalosporins.

    ID: 1678193

    Description: epitope description:cephalosporin C host organism:Homo sapiens

    Publication: 2083978;

  7. Drugs as allergens: an immunoassay for detecting IgE antibodies to cephalosporins.

    ID: 1678196

    Description: epitope description:cephapirin host organism:Homo sapiens

    Publication: 2083978;

  8. Drugs as allergens: an immunoassay for detecting IgE antibodies to cephalosporins.

    ID: 1678198

    Description: epitope description:benzylpenicillin host organism:Homo sapiens

    Publication: 2083978;

  9. Identification of linear epitopes in Bacillus anthracis protective antigen bound by neutralizing antibodies.

    ID: 1678204

    Description: epitope description:LKQKSSNSRKKRSTS antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 19617628;

  10. Advantages of a synthetic peptide immunogen over a protein immunogen in the development of an anti-pilus vaccine for Pseudomonas aeruginosa.

    ID: 1678207

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Mus musculus BALB/c

    Publication: 19519742;

  11. Identification of linear epitopes in Bacillus anthracis protective antigen bound by neutralizing antibodies.

    ID: 1678210

    Description: epitope description:VKNKRTFLSPWISNI antigen name:Protective antigen host organism:Mus musculus BALB/c antibody name:19D9, 20G7

    Publication: 19617628;

  12. A novel monoclonal antibody specific for the N-terminal end of GAD65.

    ID: 1678230

    Description: epitope description:PGSGFWSFGSEDGSGDSEN antigen name:Glutamate decarboxylase 2 host organism:Mus musculus BALB/c antibody name:N-GAD65

    Publication: 11137577;

  13. A novel monoclonal antibody specific for the N-terminal end of GAD65.

    ID: 1678233

    Description: epitope description:PGSGFWSFGSEDGSGDSEN antigen name:Glutamate decarboxylase 2 host organism:Mus musculus BALB/c antibody name:N-GAD65

    Publication: 11137577;

  14. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678339

    Description: epitope description:LTKCEVFREL antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 11729348;

  15. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678354

    Description: epitope description:TSGYDTQAIV antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 11729348;

  16. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678358

    Description: epitope description:IVQNNDSTEY antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 11729348;

  17. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678360

    Description: epitope description:NDSTEYGLFQ antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 11729348;

  18. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678366

    Description: epitope description:NKIWCKDDQN antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 11729348;

  19. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678372

    Description: epitope description:SSNICNISCD antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 11729348;

  20. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678374

    Description: epitope description:CNISCDKFLD antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 11729348;

  21. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678380

    Description: epitope description:LTDDIMCVKK antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 11729348;

  22. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678383

    Description: epitope description:CVKKILDKVG antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 11729348;

  23. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678390

    Description: epitope description:LAHKALCSEK antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 11729348;

  24. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678397

    Description: epitope description:QTMKGLDIQK antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  25. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678402

    Description: epitope description:VAGTWYSLAM antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  26. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678405

    Description: epitope description:SLAMAASDIS antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  27. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678415

    Description: epitope description:VYVEELKPTP antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  28. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678420

    Description: epitope description:EGDLEILLQK antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  29. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678422

    Description: epitope description:EILLQKWENG antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  30. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678426

    Description: epitope description:NGECAQKKII antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  31. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678427

    Description: epitope description:ECAQKKIIAE antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  32. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678433

    Description: epitope description:KIPAVFKIDA antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  33. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678434

    Description: epitope description:PAVFKIDALN antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  34. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678436

    Description: epitope description:KIDALNENKV antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  35. IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow's milk allergy.

    ID: 1678441

    Description: epitope description:LVLDTDYKKY antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 11729348;

  36. Epitope specificity of serum antibodies directed against the extracellular domain of myelin oligodendrocyte glycoprotein: Influence of relapses and im...

    ID: 1680571

    Description: epitope description:DEGGFTCFFRDH antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Homo sapiens

    Publication: 16516980;

  37. The antigenic reactivity of small fragments derived from human myelin basic protein peptide 43-88.

    ID: 1680583

    Description: epitope description:FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSGHRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Oryctolagus cunicul...

    Publication: 6183342;

  38. The antigenic reactivity of small fragments derived from human myelin basic protein peptide 43-88.

    ID: 1680589

    Description: epitope description:FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSGHRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Ovis aries

    Publication: 6183342;

  39. The antigenic reactivity of small fragments derived from human myelin basic protein peptide 43-88.

    ID: 1680592

    Description: epitope description:FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSGHRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Ovis aries

    Publication: 6183342;

  40. The antigenic reactivity of small fragments derived from human myelin basic protein peptide 43-88.

    ID: 1680596

    Description: epitope description:FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSGHRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Ovis aries

    Publication: 6183342;

  41. Epitope specificity of serum antibodies directed against the extracellular domain of myelin oligodendrocyte glycoprotein: Influence of relapses and im...

    ID: 1680597

    Description: epitope description:GWYRPPFSRVVHLYRNGKDQDGD antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Homo sapiens

    Publication: 16516980;

  42. The antigenic reactivity of small fragments derived from human myelin basic protein peptide 43-88.

    ID: 1680599

    Description: epitope description:FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSGHRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Oryctolagus cunicul...

    Publication: 6183342;

  43. The antigenic reactivity of small fragments derived from human myelin basic protein peptide 43-88.

    ID: 1680600

    Description: epitope description:FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSGHRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Ovis aries

    Publication: 6183342;

  44. The antigenic reactivity of small fragments derived from human myelin basic protein peptide 43-88.

    ID: 1680601

    Description: epitope description:FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSGHRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Oryctolagus cunicul...

    Publication: 6183342;

  45. The antigenic reactivity of small fragments derived from human myelin basic protein peptide 43-88.

    ID: 1680610

    Description: epitope description:FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSGHRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Ovis aries

    Publication: 6183342;

  46. Studies of human IgE to a sulfonamide determinant.

    ID: 1680626

    Description: epitope description:trimethoprim host organism:Homo sapiens

    Publication: 2434548;

  47. Studies of human IgE to a sulfonamide determinant.

    ID: 1680631

    Description: epitope description:sulfamethoxazole host organism:Homo sapiens

    Publication: 2434548;

  48. T and B cell responses to myelin basic protein and encephalitogenic epitopes.

    ID: 1680644

    Description: epitope description:YGSLPQKSQRSQDENPV antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis

    Publication: 7689588;

  49. T and B cell responses to myelin basic protein and encephalitogenic epitopes.

    ID: 1680656

    Description: epitope description:VHFFKNIVTPRTP antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis

    Publication: 7689588;

  50. Humoral and cellular immune responses to myelin protein peptides in chronic inflammatory demyelinating polyradiculoneuropathy.

    ID: 1680678

    Description: epitope description:YMKALGGVGLATRKLGNLAKPTVIIS antigen name:Myelin P2 protein host organism:Homo sapiens

    Publication: 19015227;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston