Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844610

    Description: epitope description:SDFWWKGKL antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  2. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844612

    Description: epitope description:DFWWKGKLV antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  3. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844616

    Description: epitope description:WWKGKLVFK antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  4. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844617

    Description: epitope description:WKGKLVFKA antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  5. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844626

    Description: epitope description:LVFKAKLRA antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  6. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844627

    Description: epitope description:VFKAKLRAS antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  7. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844634

    Description: epitope description:AKLRASHTW antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  8. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844639

    Description: epitope description:RASHTWNPI antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  9. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844640

    Description: epitope description:RASHTWNPI antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  10. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844651

    Description: epitope description:NPIQQMSIN antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  11. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844653

    Description: epitope description:PIQQMSINV antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  12. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844656

    Description: epitope description:IQQMSINVD antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  13. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844659

    Description: epitope description:QMSINVDNQ antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  14. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844664

    Description: epitope description:SINVDNQFN antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  15. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844673

    Description: epitope description:NQFNYVPSN antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  16. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844680

    Description: epitope description:NYVPSNIGG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  17. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844685

    Description: epitope description:PSNIGGMKI antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  18. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844694

    Description: epitope description:GGMKIVYEK antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  19. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844704

    Description: epitope description:VYEKSQLAP antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  20. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844707

    Description: epitope description:EKSQLAPRK antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  21. The major hormone-specific discontinuous epitopes on human chorionic gonadotrophin.

    ID: 1844713

    Description: epitope description:D111, Q139 antigen name:Choriogonadotropin subunit beta variant 2 host organism:Mus musculus antibody name:INN-68

    Publication: 15072560;

  22. A mimotope peptide of Abeta42 fibril-specific antibodies with Abeta42 fibrillation inhibitory activity induces anti-Abeta42 conformer antibody respons...

    ID: 1844717

    Description: epitope description:CYGTKPWMC host organism:Homo sapiens antibody name:B6 scFv

    Publication: 21641049;

  23. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844728

    Description: epitope description:LGLPPFLNS antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:4AG6, 3C10

    Publication: 7678305;

  24. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1844729

    Description: epitope description:GLPPFLNSL antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:4AG6, 3C10

    Publication: 7678305;

  25. Escherichia coli K88ac fimbriae expressing heat-labile and heat-stable (STa) toxin epitopes elicit antibodies that neutralize cholera toxin and STa to...

    ID: 1844734

    Description: epitope description:TKEAFATPVTGGVDGIPHIAFTDYEGASVVLRNPDGETNKKGLA antigen name:UniProt:F4MCE8 host organism:Mus musculus BALB/c antibody name:36/41

    Publication: 20980482;

  26. A mimotope peptide of Abeta42 fibril-specific antibodies with Abeta42 fibrillation inhibitory activity induces anti-Abeta42 conformer antibody respons...

    ID: 1844739

    Description: epitope description:CYGTKPWMC host organism:Mus musculus BALB/c

    Publication: 21641049;

  27. Escherichia coli K88ac fimbriae expressing heat-labile and heat-stable (STa) toxin epitopes elicit antibodies that neutralize cholera toxin and STa to...

    ID: 1844741

    Description: epitope description:CCELCCNPQCAGCY host organism:Oryctolagus cuniculus

    Publication: 20980482;

  28. Immunochemical and immunohistological expression of Lewis histo-blood group antigens in small intestine including individuals of the Le(a+b+) and Le(a...

    ID: 1837856

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc antigen name:glycolipid host organism:Mus musculus ant...

    Publication: 7696864;

  29. Immunochemical and immunohistological expression of Lewis histo-blood group antigens in small intestine including individuals of the Le(a+b+) and Le(a...

    ID: 1837858

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc antigen name:glycolipid host organism:Mus musculus ant...

    Publication: 7696864;

  30. Immunochemical and immunohistological expression of Lewis histo-blood group antigens in small intestine including individuals of the Le(a+b+) and Le(a...

    ID: 1837867

    Description: epitope description:beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc antigen name:glycolipid host organism:Mus musculus antibody name:32IEGE

    Publication: 7696864;

  31. In-depth analysis of the antibody response of individuals exposed to primary dengue virus infection.

    ID: 1837876

    Description: epitope description:V382, P384 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:DV3.7

    Publication: 21713020;

  32. In-depth analysis of the antibody response of individuals exposed to primary dengue virus infection.

    ID: 1837880

    Description: epitope description:K305, K310, E311 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:DV10.16

    Publication: 21713020;

  33. In-depth analysis of the antibody response of individuals exposed to primary dengue virus infection.

    ID: 1837888

    Description: epitope description:K70, K75, K82 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:DV21.5

    Publication: 21713020;

  34. In-depth analysis of the antibody response of individuals exposed to primary dengue virus infection.

    ID: 1837891

    Description: epitope description:K305, K307, K310 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:DV14.21

    Publication: 21713020;

  35. Development of an enzyme-linked immunosorbent assay for fentanyl and applications of fentanyl antibody-coated nanoparticles for sample preparation.

    ID: 1837913

    Description: epitope description:carboxyfentanyl host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16621415;

  36. A multimeric immunogen for the induction of immune memory to beta-amyloid.

    ID: 1837942

    Description: epitope description:DAEFRHDSGYE antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 21102534;

  37. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1837950

    Description: epitope description:REVYDFAFRDLCIVYRDGNP antigen name:Protein E6 host organism:Cavia porcellus

    Publication: 7507231;

  38. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1837965

    Description: epitope description:PDRAHYNIVTFCCKCDSTLR antigen name:Protein E7 host organism:Cavia porcellus

    Publication: 7507231;

  39. A multimeric immunogen for the induction of immune memory to beta-amyloid.

    ID: 1837973

    Description: epitope description:AEFRH antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 21102534;

  40. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1838016

    Description: epitope description:PETTDLYCY antigen name:Protein E7 host organism:Cavia porcellus

    Publication: 7507231;

  41. Recognition of type 1 chain oligosaccharides and lacto-series glycolipids by an antibody to human secretory component.

    ID: 1838018

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-D-Glc antigen name:glycoprotein host organism:Mus musculus BALB/c antibod...

    Publication: 7574700;

  42. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1838019

    Description: epitope description:CYEQLNDSSEEEDEI antigen name:Protein E7 host organism:Cavia porcellus

    Publication: 7507231;

  43. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1838022

    Description: epitope description:DSTLRLCVQSTHVDIRTLEDL antigen name:Protein E7 host organism:Cavia porcellus

    Publication: 7507231;

  44. Comparison of Gal and non-Gal-mediated cardiac xenograft rejection.

    ID: 1838442

    Description: epitope description:alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-GlcNAc host organism:Papio anubis

    Publication: 21403591;

  45. Comparison of Gal and non-Gal-mediated cardiac xenograft rejection.

    ID: 1838445

    Description: epitope description:alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-GlcNAc host organism:Papio anubis

    Publication: 21403591;

  46. The human natural anti-Gal IgG. III. The subtlety of immune tolerance in man as demonstrated by crossreactivity between natural anti-Gal and anti-B an...

    ID: 1838455

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group antigen name:glycosphingolipid host organism:Homo sapiens

    Publication: 2434599;

  47. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1838477

    Description: epitope description:LIRCINCQKPLCPEEKQRHL antigen name:Protein E6 host organism:Cavia porcellus

    Publication: 7507231;

  48. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1838490

    Description: epitope description:HGPKATLQDIVLHLEP antigen name:Protein E7 host organism:Cavia porcellus

    Publication: 7507231;

  49. The reactivities of human erythrocyte autoantibodies anti-Pr2, anti-Gd, Fl and Sa with gangliosides in a chromatogram binding assay.

    ID: 1838512

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 6204642;

  50. The reactivities of human erythrocyte autoantibodies anti-Pr2, anti-Gd, Fl and Sa with gangliosides in a chromatogram binding assay.

    ID: 1838517

    Description: epitope description:alpha-Neu5Gc-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer host organism:Homo sapiens

    Publication: 6204642;

  51. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1838521

    Description: epitope description:MFQDPQER antigen name:Protein E6 host organism:Oryctolagus cuniculus

    Publication: 7507231;

  52. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1838543

    Description: epitope description:YSKISEYRHY antigen name:Protein E6 host organism:Oryctolagus cuniculus

    Publication: 7507231;

  53. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1838545

    Description: epitope description:YSKISEYRHY antigen name:Protein E6 host organism:Oryctolagus cuniculus

    Publication: 7507231;

  54. Binding of peptides lacking consensus anchor residue alters H-2Ld serologic recognition.

    ID: 1838576

    Description: epitope description:L41, I87, Q89, I90, antigen name:H-2 class I histocompatibility antigen, L-D alpha chain host organism:Mus musculus antibody name:...

    Publication: 7693810;

  55. Fine epitope mapping of monoclonal antibodies against hemagglutinin of a highly pathogenic H5N1 influenza virus using yeast surface display.

    ID: 1838699

    Description: epitope description:T218 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:H5-2A

    Publication: 21569761;

  56. Structure and functional implications of the polymerase active site region in a complex of HIV-1 RT with a double-stranded DNA template-primer and an ...

    ID: 1838721

    Description: epitope description:R199, K223, E224, P225, P226, F227, W229, M230, R358 antigen name:Gag-Pol polyprotein host organism:Mus musculus BALB/c antibody n...

    Publication: 9837729;

  57. Structural details of HIV-1 recognition by the broadly neutralizing monoclonal antibody 2F5: epitope conformation, antigen-recognition loop mobility, ...

    ID: 1838722

    Description: epitope description:LELDKWAS antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 18824005;

  58. Structural details of HIV-1 recognition by the broadly neutralizing monoclonal antibody 2F5: epitope conformation, antigen-recognition loop mobility, ...

    ID: 1838723

    Description: epitope description:LELDKWAS antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 18824005;

  59. Structural details of HIV-1 recognition by the broadly neutralizing monoclonal antibody 2F5: epitope conformation, antigen-recognition loop mobility, ...

    ID: 1838725

    Description: epitope description:LELDKWAS antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 18824005;

  60. Carbohydrate mimicry of Campylobacter jejuni lipooligosaccharide is critical for the induction of anti-GM1 antibody and neuropathy.

    ID: 1838756

    Description: epitope description:ganglioside GM1 host organism:Cavia porcellus Hartley

    Publication: 16270308;

  61. The N-terminal region of the human papillomavirus L2 protein contains overlapping binding sites for neutralizing, cross-neutralizing and non-neutraliz...

    ID: 1838776

    Description: epitope description:TCPPDIIPK antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c antibody name:K8L2 (20-38), K12L2 (20-38)

    Publication: 21074234;

  62. The N-terminal region of the human papillomavirus L2 protein contains overlapping binding sites for neutralizing, cross-neutralizing and non-neutraliz...

    ID: 1838786

    Description: epitope description:CKQAGTCPPD antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c antibody name:K15L2 (20-38)

    Publication: 21074234;

  63. Antibodies that neutralize human beta interferon biologic activity recognize a linear epitope: analysis by synthetic peptide mapping.

    ID: 1838789

    Description: epitope description:DIPEEIKQ antigen name:Interferon beta host organism:Mus musculus BALB/c X DBA/2 antibody name:A5

    Publication: 1708891;

  64. The N-terminal region of the human papillomavirus L2 protein contains overlapping binding sites for neutralizing, cross-neutralizing and non-neutraliz...

    ID: 1838809

    Description: epitope description:IIPKVEGK antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c antibody name:K8L2 (28-42)

    Publication: 21074234;

  65. Allosteric control of ligand-binding affinity using engineered conformation-specific effector proteins.

    ID: 1838812

    Description: epitope description:H90, D113, Y116, P117, F118, T119, D121, R124, V136, V285, A327, V328, K331, E334, E335, M347, A350, Q351, G353, E354, I355, M356,...

    Publication: 21378967;

  66. The N-terminal region of the human papillomavirus L2 protein contains overlapping binding sites for neutralizing, cross-neutralizing and non-neutraliz...

    ID: 1838817

    Description: epitope description:IPLGTRP antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c antibody name:K1L2(64-81)

    Publication: 21074234;

  67. The N-terminal region of the human papillomavirus L2 protein contains overlapping binding sites for neutralizing, cross-neutralizing and non-neutraliz...

    ID: 1838822

    Description: epitope description:IPLGTRPP antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c antibody name:K2L2 (64-81), K3L2 (64-81)

    Publication: 21074234;

  68. The N-terminal region of the human papillomavirus L2 protein contains overlapping binding sites for neutralizing, cross-neutralizing and non-neutraliz...

    ID: 1838823

    Description: epitope description:IPLGTRPP antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c antibody name:K2L2 (64-81), K3L2 (64-81)

    Publication: 21074234;

  69. The N-terminal region of the human papillomavirus L2 protein contains overlapping binding sites for neutralizing, cross-neutralizing and non-neutraliz...

    ID: 1838830

    Description: epitope description:DPVGPSDP antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c antibody name:K1L2 (96-115)

    Publication: 21074234;

  70. The N-terminal region of the human papillomavirus L2 protein contains overlapping binding sites for neutralizing, cross-neutralizing and non-neutraliz...

    ID: 1838847

    Description: epitope description:GPVGPSDPSIVSLVEE antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c antibody name:K2L2 (96-115)

    Publication: 21074234;

  71. The N-terminal region of the human papillomavirus L2 protein contains overlapping binding sites for neutralizing, cross-neutralizing and non-neutraliz...

    ID: 1838848

    Description: epitope description:GPVGPSDPSIVS antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c antibody name:K3L2 (96-115), K5L2 (96-115)

    Publication: 21074234;

  72. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843246

    Description: epitope description:RARRGKGVL antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  73. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843249

    Description: epitope description:RRGKGVLVK antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  74. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843250

    Description: epitope description:RRGKGVLVK antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  75. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843254

    Description: epitope description:GKGVLVKWG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  76. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843258

    Description: epitope description:GVLVKWGEG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  77. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843259

    Description: epitope description:VLVKWGEGK antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  78. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843264

    Description: epitope description:VKWGEGKDL antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  79. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843278

    Description: epitope description:DLITMCFFI antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  80. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843288

    Description: epitope description:CFFIGLVPP antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  81. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843293

    Description: epitope description:IGLVPPGYK antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  82. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843294

    Description: epitope description:IGLVPPGYK antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  83. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843306

    Description: epitope description:GYKYLGPGN antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  84. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843313

    Description: epitope description:LGPGNSLDQ antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  85. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843314

    Description: epitope description:LGPGNSLDQ antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  86. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843324

    Description: epitope description:SLDQGEPTN antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  87. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843328

    Description: epitope description:DQGEPTNPS antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  88. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843336

    Description: epitope description:PTNPSDAAA antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  89. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843340

    Description: epitope description:NPSDAAAKE antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  90. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843342

    Description: epitope description:PSDAAAKEH antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  91. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843347

    Description: epitope description:AAAKEHDEA antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  92. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843356

    Description: epitope description:EHDEAYAAY antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  93. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843361

    Description: epitope description:EAYAAYLRS antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  94. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843365

    Description: epitope description:YAAYLRSGK antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  95. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843367

    Description: epitope description:AAYLRSGKN antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  96. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843369

    Description: epitope description:AYLRSGKNP antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  97. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843392

    Description: epitope description:YFSPADQRF antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  98. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843393

    Description: epitope description:FSPADQRFI antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;

  99. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843398

    Description: epitope description:PADQRFIDQ antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7678305;

  100. B-cell epitopes of canine parvovirus: distribution on the primary structure and exposure on the viral surface.

    ID: 1843405

    Description: epitope description:RFIDQTKDA antigen name:Capsid protein VP1 host organism:Canis lupus

    Publication: 7678305;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston