Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549526

    Description: epitope description:VTVVTTSGS antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  2. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549528

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Homo sapiens

    Publication: 15916786;

  3. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549530

    Description: epitope description:NPTIAG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  4. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549535

    Description: epitope description:GAGDVK antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  5. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549536

    Description: epitope description:AGDVKA antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  6. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549539

    Description: epitope description:VKASAE antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  7. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549545

    Description: epitope description:VTVVTTSGS antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  8. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549554

    Description: epitope description:AYEQPIERTVVGHQTLRDIFVWG antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  9. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549555

    Description: epitope description:VTVVTTSGS antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  10. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549559

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  11. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549562

    Description: epitope description:AYEQPIERTVVGHQTLRDIFVWG antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  12. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549565

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Homo sapiens

    Publication: 15916786;

  13. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549569

    Description: epitope description:GGTEESVVTASRS antigen name:Other Taenia saginata (beef tapeworm) protein host organism:Homo sapiens

    Publication: 15916786;

  14. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549576

    Description: epitope description:RFVKTPSKKKTKSR antigen name:Tsa-18 protein host organism:Homo sapiens

    Publication: 15916786;

  15. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549589

    Description: epitope description:GGTEESVVTASRS antigen name:Other Taenia saginata (beef tapeworm) protein host organism:Homo sapiens

    Publication: 15916786;

  16. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549595

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Homo sapiens

    Publication: 15916786;

  17. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549608

    Description: epitope description:VTVVTTSGS antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  18. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549612

    Description: epitope description:AYEQPIERTVVGHQTLRDIFVWG antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  19. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549613

    Description: epitope description:VTVVTTSGS antigen name:Host-protective antigen homologue host organism:Homo sapiens

    Publication: 15916786;

  20. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549616

    Description: epitope description:RFVKTPSKKKTKSR antigen name:Tsa-18 protein host organism:Homo sapiens

    Publication: 15916786;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston