Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675174

    Description: epitope description:VLRWLQLSAERGDLQ antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  2. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675175

    Description: epitope description:AERGDLQREGLYVPH antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  3. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675179

    Description: epitope description:VQVVDDNGNTVFDDE antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  4. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675180

    Description: epitope description:NTVFDDELRQGQVLT antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  5. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675182

    Description: epitope description:PQNFAVAKRAESEGF antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  6. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675183

    Description: epitope description:RAESEGFEWVAFKTN antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  7. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675189

    Description: epitope description:ARRLKYNRQETTLVR antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  8. Comparison of properties of murine monoclonal anti-idiotypic antibodies generated with idiotype-bearing monoclonal antibodies to myelin basic protein ...

    ID: 1675192

    Description: epitope description:ASQKRPSQR + ACET(1A) antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:F23C6

    Publication: 7508836;

  9. Vaccination with peptides from MHC class II beta chain hypervariable region causes allele-specific suppression of EAE.

    ID: 1675273

    Description: epitope description:AEYWNSQPEILERTRAE + ACET(A1) antigen name:H-2 class II histocompatibility antigen, A-D beta chain host organism:Mus musculus SJL X...

    Publication: 8765334;

  10. Vaccination with peptides from MHC class II beta chain hypervariable region causes allele-specific suppression of EAE.

    ID: 1675276

    Description: epitope description:AEYWNSQPEILERTRAE + ACET(A1) antigen name:H-2 class II histocompatibility antigen, A-D beta chain host organism:Mus musculus SJL X...

    Publication: 8765334;

  11. Vaccination with peptides from MHC class II beta chain hypervariable region causes allele-specific suppression of EAE.

    ID: 1675286

    Description: epitope description:AEYYNKQYLEQTRAELDT + ACET(A1) antigen name:H-2 class II histocompatibility antigen, A-S beta chain host organism:Mus musculus SJL ...

    Publication: 8765334;

  12. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675346

    Description: epitope description:PGFGYGG antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus antibody name:Clone 17

    Publication: 2448611;

  13. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675349

    Description: epitope description:PGFGYGG antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus antibody name:Clone 17

    Publication: 2448611;

  14. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675352

    Description: epitope description:WGAEGQKPGFGYGG antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus antibody name:Clone 2

    Publication: 2448611;

  15. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675354

    Description: epitope description:SLSRFSWGAE antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus norvegicus DA antibody name:Clone 2.204.2

    Publication: 2448611;

  16. A survey of the prevalence of penicillin-specific IgG, IgM and IgE antibodies detected by ELISA and defined by hapten inhibition, in patients with sus...

    ID: 1675356

    Description: epitope description:benzylpenicilloyl group host organism:Homo sapiens

    Publication: 3358899;

  17. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675363

    Description: epitope description:QDENPVVHFFKNIV antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus norvegicus Wistar antibody name:Clone 12

    Publication: 2448611;

  18. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675368

    Description: epitope description:HFFKNIVTPR antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus norvegicus DA antibody name:Clone 2.225.6

    Publication: 2448611;

  19. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675379

    Description: epitope description:DHARHGFLPRHRD antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus antibody name:MAb 1924.22

    Publication: 2448611;

  20. Generation of antibodies specific to D-mannitol, a unique haptenic allergen, using reductively aminated D-mannose-bovine serum albumin conjugate as th...

    ID: 1675388

    Description: epitope description:D-mannitol host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17336832;

  21. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675398

    Description: epitope description:KAQHGRP antigen name:Myelin basic protein host organism:Mus musculus antibody name:Clone 3

    Publication: 2448611;

  22. Monoclonal antibodies to human myelin basic protein.

    ID: 1675413

    Description: epitope description:FKNIVTPRTPPPSQGKGRGLSLSRFSW antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL antibody name...

    Publication: 2415682;

  23. Monoclonal antibodies to human myelin basic protein.

    ID: 1675416

    Description: epitope description:AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus SJL antibod...

    Publication: 2415682;

  24. Methyl tertiary-butyl ether antibodies among gasoline service station attendants.

    ID: 1675424

    Description: epitope description:methyl tert-butyl ether host organism:Homo sapiens

    Publication: 9472332;

  25. HLA class II transgenic mice authenticate restriction of myelin oligodendrocyte glycoprotein-specific immune response implicated in multiple sclerosis...

    ID: 1675510

    Description: epitope description:YRNGKDQDGDQAPEYRGRTE antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Mus musculus HLA-DQ8 Tg

    Publication: 12663683;

  26. HLA class II transgenic mice authenticate restriction of myelin oligodendrocyte glycoprotein-specific immune response implicated in multiple sclerosis...

    ID: 1675513

    Description: epitope description:QAPEYRGRTELLKDAIGEGK antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Mus musculus HLA-DQ8 Tg

    Publication: 12663683;

  27. HLA class II transgenic mice authenticate restriction of myelin oligodendrocyte glycoprotein-specific immune response implicated in multiple sclerosis...

    ID: 1675534

    Description: epitope description:AVLPVLLLQITVGLVFLCLQ antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Mus musculus HLA-DQ8 Tg

    Publication: 12663683;

  28. Induction of a multiple sclerosis-like disease in mice with an immunodominant epitope of myelin oligodendrocyte glycoprotein.

    ID: 1675735

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Rattus

    Publication: 9771980;

  29. Characterization of phosphorylcholine- (PC) specific IgE-B cells in CBA/N or (CBA/N x BALB/c)F1 male mice.

    ID: 1675747

    Description: epitope description:phosphocholine host organism:Mus musculus CBA

    Publication: 6790611;

  30. IgE antibodies for penicillins and cephalosporins in rats. III. Antigenic specificity of rat anti-cephalosporin-OvA IgE sera.

    ID: 1675762

    Description: epitope description:cefsulodin host organism:Rattus norvegicus Sprague-Dawley

    Publication: 6166604;

  31. Comparison of the immunogenicity of wasp venom peptides with or without carbohydrate moieties.

    ID: 1675763

    Description: epitope description:TATTRRRGRPPGFSPFR antigen name:Vespula maculifrons (eastern yellowjacket) protein host organism:Mus musculus BALB/c

    Publication: 9604295;

  32. IgE antibodies for penicillins and cephalosporins in rats. III. Antigenic specificity of rat anti-cephalosporin-OvA IgE sera.

    ID: 1675768

    Description: epitope description:cefsulodin host organism:Rattus norvegicus Sprague-Dawley

    Publication: 6166604;

  33. IgE antibodies for penicillins and cephalosporins in rats. III. Antigenic specificity of rat anti-cephalosporin-OvA IgE sera.

    ID: 1675773

    Description: epitope description:sulbenicillin host organism:Rattus norvegicus Sprague-Dawley

    Publication: 6166604;

  34. IgE antibodies for penicillins and cephalosporins in rats. III. Antigenic specificity of rat anti-cephalosporin-OvA IgE sera.

    ID: 1675788

    Description: epitope description:cefaloridine host organism:Rattus norvegicus Sprague-Dawley

    Publication: 6166604;

  35. Heterogeneity of IgE epitopes of vinyl sulphone reactive dye: human serum albumin that react with IgE.

    ID: 1675814

    Description: epitope description:remazole black-GR host organism:Homo sapiens

    Publication: 11696055;

  36. Autoimmune spread to myelin is associated with experimental autoimmune encephalomyelitis induced by a neuronal protein, beta-synuclein.

    ID: 1675827

    Description: epitope description:KKEEFPTDLKPEEVAQEAAEEPLIE antigen name:Beta-synuclein host organism:Rattus norvegicus Lewis

    Publication: 19189872;

  37. Autoimmune spread to myelin is associated with experimental autoimmune encephalomyelitis induced by a neuronal protein, beta-synuclein.

    ID: 1675833

    Description: epitope description:LKPEEVAQEAAEEPLIEPL antigen name:Beta-synuclein host organism:Rattus norvegicus Lewis

    Publication: 19189872;

  38. Autoimmune spread to myelin is associated with experimental autoimmune encephalomyelitis induced by a neuronal protein, beta-synuclein.

    ID: 1675837

    Description: epitope description:GVLYVGSKTSGVVQGVASVAEKTKE antigen name:Beta-synuclein host organism:Rattus norvegicus Lewis

    Publication: 19189872;

  39. Autoimmune spread to myelin is associated with experimental autoimmune encephalomyelitis induced by a neuronal protein, beta-synuclein.

    ID: 1675838

    Description: epitope description:VQGVASVAEKTKEQASHLGGAVFSG antigen name:Beta-synuclein host organism:Rattus norvegicus Lewis

    Publication: 19189872;

  40. Autoimmune spread to myelin is associated with experimental autoimmune encephalomyelitis induced by a neuronal protein, beta-synuclein.

    ID: 1675842

    Description: epitope description:EVAQEAAEEPLIEPLMEPEGESYED antigen name:Beta-synuclein host organism:Rattus norvegicus Lewis

    Publication: 19189872;

  41. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675861

    Description: epitope description:IPKVPPGPNITA antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  42. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675869

    Description: epitope description:WYGKPTAAGP antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  43. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675875

    Description: epitope description:YKDVDKPPFS antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  44. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675876

    Description: epitope description:VDKPPFSGMT antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  45. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675878

    Description: epitope description:IPKVPPGPNITA + HYL(P5, P8) antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  46. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675879

    Description: epitope description:VPPGPNITAT + HYL(P2, P5) antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  47. Differential effects of IL-21 during initiation and progression of autoimmunity against neuroantigen.

    ID: 1675909

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Mus musculus C57BL/6

    Publication: 15728477;

  48. Differential effects of IL-21 during initiation and progression of autoimmunity against neuroantigen.

    ID: 1675910

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Mus musculus C57BL/6

    Publication: 15728477;

  49. Differential effects of IL-21 during initiation and progression of autoimmunity against neuroantigen.

    ID: 1675911

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Mus musculus C57BL/6

    Publication: 15728477;

  50. Relevance of IgE binding to short peptides for the allergenic activity of food allergens.

    ID: 1683806

    Description: epitope description:LRAPQRCDLEVESGG antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 19596143;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston