Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Molecular immune recognition of botulinum neurotoxin B. The light chain regions that bind human blocking antibodies from toxin-treated cervical dyston...

    ID: 1906567

    Description: epitope description:KYSIDVESFDKLYKSLMFG antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 21962573;

  2. Molecular immune recognition of botulinum neurotoxin B. The light chain regions that bind human blocking antibodies from toxin-treated cervical dyston...

    ID: 1906570

    Description: epitope description:PPVKIKNLLDNEIYTIEEG antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 21962573;

  3. Molecular immune recognition of botulinum neurotoxin B. The light chain regions that bind human blocking antibodies from toxin-treated cervical dyston...

    ID: 1906573

    Description: epitope description:YEEISKEHLAVYKIQMCKS antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 21962573;

  4. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906756

    Description: epitope description:N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR2A

    Publication: 18064037;

  5. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906759

    Description: epitope description:S424, H488, G523, P525, D535, V538, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3C

    Publication: 18064037;

  6. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906777

    Description: epitope description:Q412, T416, G418, N423, S424, G523, P525, G530, D535, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody nam...

    Publication: 18064037;

  7. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906779

    Description: epitope description:Q412, S424, G523, D535 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3D

    Publication: 18064037;

  8. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906800

    Description: epitope description:Q412, W420, N423, R483, P484, Y485, G523, P525, T526, G530, T534, N540, P544, P545, G547, W549 antigen name:Genome polyprotein hos...

    Publication: 18064037;

  9. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906801

    Description: epitope description:Q412, W420, N423, R483, P484, Y485, G523, P525, T526, G530, T534, N540, P544, P545, G547, W549 antigen name:Genome polyprotein hos...

    Publication: 18064037;

  10. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906802

    Description: epitope description:N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR2A

    Publication: 18064037;

  11. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906822

    Description: epitope description:Q412, T416, G418, N423, S424, G523, P525, G530, D535, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody nam...

    Publication: 18064037;

  12. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906841

    Description: epitope description:Q412, S424, G523, D535 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3D

    Publication: 18064037;

  13. Rat monoclonal antibodies against Aspergillus galactomannan.

    ID: 1865026

    Description: epitope description:beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf antigen name:galactomannan host organism:Rattus norvegicus LO...

    Publication: 1375195;

  14. Rat monoclonal antibodies against Aspergillus galactomannan.

    ID: 1865056

    Description: epitope description:beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf antigen name:galactomannan host organism:Rattus norvegicus LO...

    Publication: 1375195;

  15. Rat monoclonal antibodies against Aspergillus galactomannan.

    ID: 1865059

    Description: epitope description:beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf antigen name:galactomannan host organism:Rattus norvegicus LO...

    Publication: 1375195;

  16. Rat monoclonal antibodies against Aspergillus galactomannan.

    ID: 1865061

    Description: epitope description:beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf antigen name:galactomannan host organism:Rattus norvegicus LO...

    Publication: 1375195;

  17. Spot synthesis of overlapping peptides on paper membrane supports enables the identification of linear monoclonal antibody binding determinants on mor...

    ID: 1865094

    Description: epitope description:ELFSEIQEIR antigen name:phosphoprotein host organism:Mus musculus C57BL/6 antibody name:PD/Px5

    Publication: 8588324;

  18. Spot synthesis of overlapping peptides on paper membrane supports enables the identification of linear monoclonal antibody binding determinants on mor...

    ID: 1865099

    Description: epitope description:ENP antigen name:phosphoprotein host organism:Mus musculus BALB/c antibody name:3.768

    Publication: 8588324;

  19. Antibody recognition of a unique tumor-specific glycopeptide antigen.

    ID: 1865107

    Description: epitope description:ERGTKPPLEELS + GAL(T4) antigen name:Podoplanin (UniProt:Q62011) host organism:Mus musculus C3H/He antibody name:237mAb

    Publication: 20479270;

  20. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1865138

    Description: epitope description:ADLGDFENSAAAAETGVGVIKSIA antigen name:UniProt:A5F392 host organism:Mus musculus B10.A-H2a H2-T18a/SgSnJ

    Publication: 11705949;

  21. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1865201

    Description: epitope description:AATGAGVIKSIAPGSANLNLTNITH antigen name:Toxin coregulated pilin host organism:Mus musculus B10.A-H2a H2-T18a/SgSnJ

    Publication: 11705949;

  22. Species-specific B-cell epitope on the C-terminal region of the alpha antigen from Mycobacterium intracellulare in mice.

    ID: 1865388

    Description: epitope description:LQSALGASSGGGG antigen name:Antigen 85-B host organism:Mus musculus BALB/c

    Publication: 10068124;

  23. Species-specific B-cell epitope on the C-terminal region of the alpha antigen from Mycobacterium intracellulare in mice.

    ID: 1865389

    Description: epitope description:LQSALGASSGGGG antigen name:Antigen 85-B host organism:Mus musculus BALB/c

    Publication: 10068124;

  24. Neutralization escape variant of West Nile virus associated with altered peripheral pathogenicity and differential cytokine profile.

    ID: 1865403

    Description: epitope description:E50, E89, E156, E242 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:IF1A7

    Publication: 21470570;

  25. Neutralization escape variant of West Nile virus associated with altered peripheral pathogenicity and differential cytokine profile.

    ID: 1865412

    Description: epitope description:E50, E89, E242 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:IVC3FG10

    Publication: 21470570;

  26. The specificity of allergic reactions. VI. Unresponsiveness to simple chemicals.

    ID: 1865509

    Description: epitope description:2,4-dinitrophenyl group host organism:Cavia porcellus Hartley

    Publication: 14021926;

  27. The specificity of allergic reactions. VI. Unresponsiveness to simple chemicals.

    ID: 1865512

    Description: epitope description:2,4-dinitrophenyl group host organism:Cavia porcellus Hartley

    Publication: 14021926;

  28. Minor nucleotide substitutions in the omp31 gene of Brucella ovis result in antigenic differences in the major outer membrane protein that it encodes ...

    ID: 1865602

    Description: epitope description:NAGYAGGKFKHPFSSFDKEDGEHVSGSPDVTAGGFV antigen name:UniProt:A5VUA5 host organism:Mus musculus BALB/c antibody name:A01/08H06/G02

    Publication: 11598077;

  29. Minor nucleotide substitutions in the omp31 gene of Brucella ovis result in antigenic differences in the major outer membrane protein that it encodes ...

    ID: 1865605

    Description: epitope description:NAGYAGGKFKHPFSSFDKEDGEHVSGSPDVTAGGFV antigen name:UniProt:A5VUA5 host organism:Mus musculus BALB/c antibody name:A01/08H06/G02

    Publication: 11598077;

  30. Identification of one critical amino acid that determines a conformational neutralizing epitope in the capsid protein of porcine circovirus type 2.

    ID: 1865611

    Description: epitope description:A59 antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:8E4

    Publication: 21859462;

  31. Developing subunit immunogens using B and T cell epitopes and their constructs derived from the F1 antigen of Yersinia pestis using novel delivery veh...

    ID: 1865652

    Description: epitope description:TGSQDFFVRSIG antigen name:F1 capsule antigen host organism:Mus musculus FVB/J antibody name:Serum

    Publication: 14522457;

  32. Functional characterization of the maltose ATP-binding-cassette transporter of Salmonella typhimurium by means of monoclonal antibodies directed again...

    ID: 1865706

    Description: epitope description:LFIG antigen name:Maltose/maltodextrin import ATP-binding protein MalK host organism:Mus musculus BALB/c antibody name:5B5

    Publication: 12180984;

  33. Functional characterization of the maltose ATP-binding-cassette transporter of Salmonella typhimurium by means of monoclonal antibodies directed again...

    ID: 1865709

    Description: epitope description:RVNQVAEVLQL antigen name:Maltose/maltodextrin import ATP-binding protein MalK host organism:Mus musculus BALB/c antibody name:4H12

    Publication: 12180984;

  34. Functional characterization of the maltose ATP-binding-cassette transporter of Salmonella typhimurium by means of monoclonal antibodies directed again...

    ID: 1865710

    Description: epitope description:RVNQVAEVLQL antigen name:Maltose/maltodextrin import ATP-binding protein MalK host organism:Mus musculus BALB/c antibody name:4H12

    Publication: 12180984;

  35. Functional characterization of the maltose ATP-binding-cassette transporter of Salmonella typhimurium by means of monoclonal antibodies directed again...

    ID: 1865712

    Description: epitope description:RVNQVAEVLQL antigen name:Maltose/maltodextrin import ATP-binding protein MalK host organism:Mus musculus BALB/c antibody name:4H12

    Publication: 12180984;

  36. Functional characterization of the maltose ATP-binding-cassette transporter of Salmonella typhimurium by means of monoclonal antibodies directed again...

    ID: 1865725

    Description: epitope description:LFREDGSACR antigen name:Maltose/maltodextrin import ATP-binding protein MalK host organism:Mus musculus BALB/c antibody name:4B3

    Publication: 12180984;

  37. Structural basis for EGF receptor inhibition by the therapeutic antibody IMC-11F8.

    ID: 1865850

    Description: epitope description:P373, R377, Q408, Q432, H433, S442, S464, K467, K489, I491, S492, N497 antigen name:Epidermal growth factor receptor host organism...

    Publication: 18275813;

  38. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866024

    Description: epitope description:V102, L229 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:XJ13

    Publication: 21744000;

  39. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866037

    Description: epitope description:V102 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:XJ04

    Publication: 21744000;

  40. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866042

    Description: epitope description:A76, I203 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:QH02

    Publication: 21744000;

  41. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866043

    Description: epitope description:A76, I203 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:QH02

    Publication: 21744000;

  42. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866052

    Description: epitope description:AETGVGVIKSIAPASKNLDLTNITH antigen name:UniProt:A5F392 host organism:Mus musculus BALB.B

    Publication: 11705949;

  43. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866058

    Description: epitope description:NNAYP antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:QH05

    Publication: 21744000;

  44. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866064

    Description: epitope description:ADLGDFETSVADAATGAGVIKSIA antigen name:Toxin coregulated pilin host organism:Mus musculus B10.A-H2a H2-T18a/SgSnJ

    Publication: 11705949;

  45. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866066

    Description: epitope description:AATGAGVIKSIAPGSANLNLTNITH antigen name:Toxin coregulated pilin host organism:Mus musculus B10.D2-Hc1 H2d H2-T18c/nSn

    Publication: 11705949;

  46. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866077

    Description: epitope description:LDLTNITHVEKLCKGTAPFGVAFGNS antigen name:UniProt:A5F392 host organism:Mus musculus B10.A-H2a H2-T18a/SgSnJ

    Publication: 11705949;

  47. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866078

    Description: epitope description:LNLTNITHVEKLCTGTAPFTVAFGNS antigen name:Toxin coregulated pilin host organism:Mus musculus B10.D2-Hc1 H2d H2-T18c/nSn

    Publication: 11705949;

  48. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866079

    Description: epitope description:LNLTNITHVEKLCTGTAPFTVAFGNS antigen name:Toxin coregulated pilin host organism:Mus musculus B10.BR-H2k H2-T18a/SgSnJ

    Publication: 11705949;

  49. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866089

    Description: epitope description:V102, T172 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:XJ15

    Publication: 21744000;

  50. Mapping IgE binding epitopes of major shrimp (Penaeus monodon) allergen with immunoinformatics tools.

    ID: 1866161

    Description: epitope description:DTLEQQNKEANNRAEKSE antigen name:Pen m 1 host organism:Homo sapiens

    Publication: 21802470;

  51. Mapping IgE binding epitopes of major shrimp (Penaeus monodon) allergen with immunoinformatics tools.

    ID: 1866164

    Description: epitope description:NLQKRMQQLENDLDQ antigen name:Pen m 1 host organism:Homo sapiens

    Publication: 21802470;

  52. Mapping IgE binding epitopes of major shrimp (Penaeus monodon) allergen with immunoinformatics tools.

    ID: 1866165

    Description: epitope description:NRRIQLLEEDLERSEER antigen name:Pen m 1 host organism:Homo sapiens

    Publication: 21802470;

  53. Mapping IgE binding epitopes of major shrimp (Penaeus monodon) allergen with immunoinformatics tools.

    ID: 1866169

    Description: epitope description:ERAEERAETGESKI antigen name:Pen m 1 host organism:Homo sapiens

    Publication: 21802470;

  54. Mapping IgE binding epitopes of major shrimp (Penaeus monodon) allergen with immunoinformatics tools.

    ID: 1866171

    Description: epitope description:ERSVQKLQKEVDRLEDE antigen name:Pen m 1 host organism:Homo sapiens

    Publication: 21802470;

  55. Mapping IgE binding epitopes of major shrimp (Penaeus monodon) allergen with immunoinformatics tools.

    ID: 1866172

    Description: epitope description:EKEKYKSITDELDQTFSE antigen name:Pen m 1 host organism:Homo sapiens

    Publication: 21802470;

  56. Mapping IgE binding epitopes of major shrimp (Penaeus monodon) allergen with immunoinformatics tools.

    ID: 1866176

    Description: epitope description:EASQAADESERMRK antigen name:Pen m 1 host organism:Homo sapiens

    Publication: 21802470;

  57. Mapping IgE binding epitopes of major shrimp (Penaeus monodon) allergen with immunoinformatics tools.

    ID: 1866181

    Description: epitope description:ERSVQKLQKEVDRLEDE antigen name:Pen m 1 host organism:Homo sapiens

    Publication: 21802470;

  58. Mapping IgE binding epitopes of major shrimp (Penaeus monodon) allergen with immunoinformatics tools.

    ID: 1866182

    Description: epitope description:EKEKYKSITDELDQTFSE antigen name:Pen m 1 host organism:Homo sapiens

    Publication: 21802470;

  59. Novel blood group H glycolipid antigens exclusively expressed in blood group A and AB erythrocytes (type 3 chain H). II. Differential conversion of di...

    ID: 1866290

    Description: epitope description:alpha-L-Fucp-(1->2) -[alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-alpha-D-GlcpNAc-(1->3)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta...

    Publication: 3944092;

  60. Promiscuous peptide of 16 kDa antigen linked to Pam2Cys protects against Mycobacterium tuberculosis by evoking enduring memory T-cell response.

    ID: 1866339

    Description: epitope description:SEFAYGSFVRTVSLPVGADE antigen name:Alpha-crystallin host organism:Homo sapiens

    Publication: 21933875;

  61. A human monoclonal antibody against insulin-like growth factor-II blocks the growth of human hepatocellular carcinoma cell lines in vitro and in vivo.

    ID: 1866374

    Description: epitope description:T31, C33, G34, G35, E36, V38, D39, L41, F50, R58, V59, R64, V67, E68, E69, C71, F72, R73, Y83 antigen name:Insulin-like growth fac...

    Publication: 20515953;

  62. Antibody-based targeting of FGFR3 in bladder carcinoma and t(4;14)-positive multiple myeloma in mice.

    ID: 1866380

    Description: epitope description:R155, R158, M159, K161, K162, L163, L164, V166, P167, A168, A169, N170, T171, V172, R173, R175, P177, K205, R207, Q210, V214, E216...

    Publication: 19381019;

  63. Antibody-based targeting of FGFR3 in bladder carcinoma and t(4;14)-positive multiple myeloma in mice.

    ID: 1866384

    Description: epitope description:R155, R158, M159, K161, K162, L163, L164, V166, P167, A168, A169, N170, T171, V172, R173, R175, P177, K205, R207, Q210, V214, E216...

    Publication: 19381019;

  64. A DNA vaccine encoding foot-and-mouth disease virus B and T-cell epitopes targeted to class II swine leukocyte antigens protects pigs against viral ch...

    ID: 1866391

    Description: epitope description:TTTYTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Sus scrofa Landrace X Large White

    Publication: 21820470;

  65. Structure-based vaccines provide protection in a mouse model of ehrlichiosis.

    ID: 1898731

    Description: epitope description:AKEEKNATAKTFGLKQDWDGA antigen name:Membrane protein (UniProt:V9R8J8) host organism:Canis lupus familiaris

    Publication: 22114733;

  66. Structure-based vaccines provide protection in a mouse model of ehrlichiosis.

    ID: 1898758

    Description: epitope description:YGAPEITKDGYKVIKSIK antigen name:60 kDa chaperonin host organism:Mus musculus C57BL/6

    Publication: 22114733;

  67. Antigenic mimicry-mediated anti-prion effects induced by bacterial enzyme succinylarginine dihydrolase in mice.

    ID: 1898799

    Description: epitope description:SAVSRPMIHFGNDWEDRYYRENMY antigen name:Major prion protein host organism:Mus musculus BALB/c

    Publication: 22008817;

  68. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898806

    Description: epitope description:FQNIASMPHLYV host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  69. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898814

    Description: epitope description:APHNKWPHLNPP host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  70. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898815

    Description: epitope description:AHSEMGTRATMT host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  71. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898818

    Description: epitope description:DMSYYYALPTYT host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  72. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898820

    Description: epitope description:MAITDHPGSAMV host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  73. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898822

    Description: epitope description:YTSLPAPMQRLP host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  74. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898823

    Description: epitope description:DAWKMRLSQMYD host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  75. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898824

    Description: epitope description:VNYNGKEHLLIP host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  76. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898828

    Description: epitope description:AGLPNHNAMLLT host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  77. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898839

    Description: epitope description:HAWQSKTPDKTR host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  78. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898841

    Description: epitope description:HVRIPPTMPEAW host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  79. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898847

    Description: epitope description:SQKYFNDLLDHQ host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  80. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898848

    Description: epitope description:KPVVGMPIVEVW host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  81. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898851

    Description: epitope description:SYGSSVTQHLAT host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  82. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898857

    Description: epitope description:DPHVFKS host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  83. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898862

    Description: epitope description:GLHANLQ host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  84. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898867

    Description: epitope description:LAHPFTP host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  85. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898879

    Description: epitope description:YHAHPLD host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  86. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898891

    Description: epitope description:DSQKPCKCHCTMTQ host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  87. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898899

    Description: epitope description:PGPRFF host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  88. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898900

    Description: epitope description:QLHTSI host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  89. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898907

    Description: epitope description:NLHTSF host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  90. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898908

    Description: epitope description:PAPRFF host organism:Gallus gallus White Leghorn

    Publication: 21844329;

  91. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898918

    Description: epitope description:AHSEMGTRATMT host organism:Bos taurus

    Publication: 21844329;

  92. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898934

    Description: epitope description:VNWNSWHKTNLS host organism:Mus musculus BALB/c

    Publication: 21844329;

  93. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898939

    Description: epitope description:IDPLMFKYWYNM host organism:Mus musculus BALB/c

    Publication: 21844329;

  94. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898940

    Description: epitope description:SHDGASSKIRPA host organism:Mus musculus BALB/c

    Publication: 21844329;

  95. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898943

    Description: epitope description:PLSKMHI host organism:Mus musculus BALB/c

    Publication: 21844329;

  96. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898951

    Description: epitope description:DKSKKCEKNCAPMV host organism:Mus musculus BALB/c

    Publication: 21844329;

  97. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898953

    Description: epitope description:AKLITCSKTCSKWQ host organism:Mus musculus BALB/c

    Publication: 21844329;

  98. Antigen fingerprinting of polyclonal antibodies raised in immunized chickens with tick total proteins: a reservoir for the discovery of novel antigens...

    ID: 1898958

    Description: epitope description:PGPRFF host organism:Mus musculus BALB/c

    Publication: 21844329;

  99. Silicate antibodies in women with silicone breast implants: development of an assay for detection of humoral immunity.

    ID: 1898987

    Description: epitope description:sodium silicate host organism:Homo sapiens

    Publication: 8991630;

  100. Silicate antibodies in women with silicone breast implants: development of an assay for detection of humoral immunity.

    ID: 1898992

    Description: epitope description:sodium silicate host organism:Homo sapiens

    Publication: 8991630;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston