Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1551324

    Description: epitope description:AATSGATAAASA antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  2. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1551333

    Description: epitope description:ASAAAAVDTGSG antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  3. Purification of E. coli-synthesized Pan proteins and development of a Pan-specific monoclonal antibody.

    ID: 1551446

    Description: epitope description:RDATAYPSAKTPSS antigen name:Transcription factor E2-alpha (UniProt:P15923) host organism:Mus musculus Swiss Webster antibody name:...

    Publication: 7523277;

  4. Induction of systemic immune responses to measles virus synthetic peptides administered intranasally.

    ID: 1551451

    Description: epitope description:INQDPDKILTY antigen name:Fusion glycoprotein F0 host organism:Mus musculus CBA

    Publication: 8578832;

  5. Analysis of a conformation-independent epitope and a conformational epitope in a protein: a study on cobrotoxin from Taiwan cobra venom.

    ID: 1552016

    Description: epitope description:TNCYKKRWRDHRGYRTE antigen name:Cobrotoxin homolog host organism:Oryctolagus cuniculus

    Publication: 7592551;

  6. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1553475

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Oryctolagus cuniculus

    Publication: 7678312;

  7. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1553478

    Description: epitope description:GSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:E1-18

    Publication: 7678312;

  8. Therapeutic efficacy of a conjugate vaccine containing a peptide mimotope of cryptococcal capsular polysaccharide glucuronoxylomannan.

    ID: 1553482

    Description: epitope description:GMDGTQLDRW host organism:Mus musculus BALB/c

    Publication: 18524882;

  9. Intranasal immunization of guinea pigs with an immunodominant foot-and-mouth disease virus peptide conjugate induces mucosal and humoral antibodies an...

    ID: 1553691

    Description: epitope description:GSGVRGDFGSLAPRVARQL antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 12805448;

  10. The neutralization epitope of lactate dehydrogenase-elevating virus is located on the short ectodomain of the primary envelope glycoprotein.

    ID: 1553711

    Description: epitope description:ACAAGNSSTKNLIYNLTLCELNVTGFQQHF antigen name:major structural glycoprotein GP5 host organism:Mus musculus

    Publication: 9514969;

  11. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510854

    Description: epitope description:SRAPPPPEERQESRSQTPAPKPSRAPP antigen name:Structural polyprotein host organism:Oryctolagus cuniculus

    Publication: 1371169;

  12. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510855

    Description: epitope description:SRAPPQQPQPPRMQTGRGGSAPRPELGP antigen name:Structural polyprotein host organism:Oryctolagus cuniculus

    Publication: 1371169;

  13. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510859

    Description: epitope description:PLPPHTTERIETRSARHPWRIRFGAP antigen name:Structural polyprotein host organism:Oryctolagus cuniculus

    Publication: 1371169;

  14. Analysis of T- and B-cell epitopes of capsid protein of rubella virus by using synthetic peptides.

    ID: 1510862

    Description: epitope description:GTPPLDEDGRWDPALMYNPCGPEPPAHV antigen name:Structural polyprotein host organism:Oryctolagus cuniculus

    Publication: 1371169;

  15. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510863

    Description: epitope description:PSCSPTNMIMDGTASVNIPA antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  16. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510864

    Description: epitope description:MDGTASVNIPAGTYDFAIAA antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  17. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510866

    Description: epitope description:PQANAKIWIAGQGPTKEDDY antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  18. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510868

    Description: epitope description:LMKKMGSGDGTELTISEGGG antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  19. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510869

    Description: epitope description:TELTISEGGGSDYTYTVYRD antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;

  20. The relationship between colonization and haemagglutination inhibiting and B cell epitopes of Porphyromonas gingivalis.

    ID: 1510874

    Description: epitope description:YTAGVSPKVCKDVTVEGSNE antigen name:Arginine-specific cysteine proteinase RgpA host organism:Homo sapiens

    Publication: 9367414;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston