Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Immune responses in mice following immunization with chimeric synthetic peptides representing B and T cell epitopes of measles virus proteins.

    ID: 1476320

    Description: epitope description:INQDPDKILTY antigen name:Fusion glycoprotein F0 host organism:Mus musculus A/J antibody name:mouse serum

    Publication: 1710646;

  2. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476330

    Description: epitope description:HITDDNEEPIAPYHFDLSGHA antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  3. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476332

    Description: epitope description:TDDNEEPIAPYHFDLSGHAFGAMA antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  4. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476334

    Description: epitope description:NEEPIAPYHFDLSGHAFG antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  5. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476337

    Description: epitope description:EQKLRSAGELELQFRRVKC antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  6. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476342

    Description: epitope description:RYTTEGGTKTEAE antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  7. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476351

    Description: epitope description:CFEIKCTKPEACSGEPVVV antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  8. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476353

    Description: epitope description:KCTKPEACSGEPVVVHITDDNEEPIAPYHFDLS antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  9. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476354

    Description: epitope description:KCTKPEACSGEPVVVHITDDNEEPIAPYHFDLS antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  10. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476358

    Description: epitope description:TKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGA antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston