Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412142

    Description: epitope description:ESLKISQAVHAA antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  2. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412147

    Description: epitope description:ISQAVHAAHAEI antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  3. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412150

    Description: epitope description:QAVHAAHAEINE antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  4. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412151

    Description: epitope description:QAVHAAHAEINE antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  5. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412165

    Description: epitope description:NEAGREVVGSAE antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  6. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412167

    Description: epitope description:AGREVVGSAEAG antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  7. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412174

    Description: epitope description:VVGSAEAGVDAA antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  8. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412176

    Description: epitope description:GSAEAGVDAASV antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  9. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412177

    Description: epitope description:GSAEAGVDAASV antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  10. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412182

    Description: epitope description:AGVDAASVSEEF antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  11. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412210

    Description: epitope description:LFCIKHIATNAV antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  12. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412216

    Description: epitope description:KHIATNAVLFFG antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  13. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412228

    Description: epitope description:INKVVRFD antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  14. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412243

    Description: epitope description:AVLFFGRCVS antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  15. Prevalence of circulating antibodies against a streptokinase C-terminal peptide in normal blood donors.

    ID: 1412276

    Description: epitope description:PEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK antigen name:Streptokinase host organism:Homo sapiens

    Publication: 10491315;

  16. B-cell epitopes as a screening instrument for persistent cow's milk allergy.

    ID: 1412290

    Description: epitope description:LEIVPNSAE antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 12170271;

  17. B-cell epitopes as a screening instrument for persistent cow's milk allergy.

    ID: 1412291

    Description: epitope description:MKEGIHAQQK antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 12170271;

  18. B-cell epitopes as a screening instrument for persistent cow's milk allergy.

    ID: 1412292

    Description: epitope description:MKEGIHAQQK antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 12170271;

  19. B-cell epitopes as a screening instrument for persistent cow's milk allergy.

    ID: 1412296

    Description: epitope description:ENLCSTFCKE antigen name:Bos d 10 host organism:Homo sapiens antibody name:patient sera

    Publication: 12170271;

  20. B-cell epitopes as a screening instrument for persistent cow's milk allergy.

    ID: 1412306

    Description: epitope description:NRLNFLKKIS antigen name:Bos d 10 host organism:Homo sapiens antibody name:patient sera

    Publication: 12170271;

  21. B-cell epitopes as a screening instrument for persistent cow's milk allergy.

    ID: 1412312

    Description: epitope description:FFSDKIAKYI antigen name:Bos d 12 host organism:Homo sapiens antibody name:patient sera

    Publication: 12170271;

  22. B-cell epitopes as a screening instrument for persistent cow's milk allergy.

    ID: 1412319

    Description: epitope description:VRSPAQILQW antigen name:Bos d 12 host organism:Homo sapiens antibody name:patient sera

    Publication: 12170271;

  23. B-cell epitopes as a screening instrument for persistent cow's milk allergy.

    ID: 1412323

    Description: epitope description:DKTEIPTINT antigen name:Bos d 12 host organism:Homo sapiens antibody name:patient sera

    Publication: 12170271;

  24. B-cell epitopes as a screening instrument for persistent cow's milk allergy.

    ID: 1412325

    Description: epitope description:VESTVATLED antigen name:Bos d 12 host organism:Homo sapiens antibody name:patient sera

    Publication: 12170271;

  25. B-cell epitopes as a screening instrument for persistent cow's milk allergy.

    ID: 1412332

    Description: epitope description:KDLKGYGGVS antigen name:Bos d 4 host organism:Homo sapiens antibody name:patient sera

    Publication: 12170271;

  26. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412359

    Description: epitope description:KVVR antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  27. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412361

    Description: epitope description:ISQAVHAAHA antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  28. Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

    ID: 1412362

    Description: epitope description:KVYL antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 17236828;

  29. Some human B and T cell epitopes of bovine serum albumin, the major beef allergen.

    ID: 1412605

    Description: epitope description:PKIETMREKVLTSS antigen name:Bos d 6 host organism:Homo sapiens antibody name:patient sera

    Publication: 12054661;

  30. Some human B and T cell epitopes of bovine serum albumin, the major beef allergen.

    ID: 1412612

    Description: epitope description:HPEYAVSVLL antigen name:Bos d 6 host organism:Homo sapiens antibody name:patient sera

    Publication: 12054661;

  31. Some human B and T cell epitopes of bovine serum albumin, the major beef allergen.

    ID: 1412619

    Description: epitope description:PVESKVT antigen name:Bos d 6 host organism:Homo sapiens antibody name:patient sera

    Publication: 12054661;

  32. Some human B and T cell epitopes of bovine serum albumin, the major beef allergen.

    ID: 1412622

    Description: epitope description:LILNR antigen name:Bos d 6 host organism:Homo sapiens antibody name:patient sera

    Publication: 12054661;

  33. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413566

    Description: epitope description:AADMIMHTPGCVPC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  34. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413568

    Description: epitope description:AADMIMHTPGCVPC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  35. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413577

    Description: epitope description:VDLLVGAAAFCSAM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  36. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413587

    Description: epitope description:SLYPGHVSGHRMAW antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  37. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413597

    Description: epitope description:SGHRMAWDMMMNW antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  38. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413601

    Description: epitope description:TALVVSQLLRIPQAV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  39. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413602

    Description: epitope description:TALVVSQLLRIPQAV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  40. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413604

    Description: epitope description:TALVVSQLLRIPQAV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  41. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413606

    Description: epitope description:VDMVAGAHWGVLAGLA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  42. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413616

    Description: epitope description:FSPGPSQKIQLVNT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  43. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413621

    Description: epitope description:SQKIQLVNTNGSWH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  44. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413626

    Description: epitope description:MASCRPIDKFDQGW antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  45. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413637

    Description: epitope description:NIGGVGNNTLTCPT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  46. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413651

    Description: epitope description:SVAGAHGILSFLVF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  47. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413657

    Description: epitope description:LVPGAAYALYGVWP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  48. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413659

    Description: epitope description:LVPGAAYALYGVWP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  49. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413669

    Description: epitope description:VFVGLVLLTLSPYY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  50. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413672

    Description: epitope description:KVFLARLIWWLQYF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  51. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413674

    Description: epitope description:KVFLARLIWWLQYF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  52. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413680

    Description: epitope description:RAEAHLQVWVPPLN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  53. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413683

    Description: epitope description:AIILLTCAVHPELI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  54. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413689

    Description: epitope description:LGPLMVLQAGITRV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  55. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413702

    Description: epitope description:DMETKIITWGADTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  56. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413710

    Description: epitope description:LGPADSLEGQGWRL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  57. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413712

    Description: epitope description:KNQVEGEVQVVSTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  58. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413713

    Description: epitope description:KNQVEGEVQVVSTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  59. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413714

    Description: epitope description:KNQVEGEVQVVSTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  60. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413715

    Description: epitope description:KNQVEGEVQVVSTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  61. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413721

    Description: epitope description:GSKTLAGPKGPITQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  62. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413731

    Description: epitope description:GARSLTPCTCGSSD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  63. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413737

    Description: epitope description:VESMETTMRSPVFT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  64. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413742

    Description: epitope description:DECHSTDSTTILGI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  65. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413753

    Description: epitope description:ELAAKLSGLGLNAV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  66. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413757

    Description: epitope description:IDCNTCVTQTVDFS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  67. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413760

    Description: epitope description:IDCNTCVTQTVDFS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  68. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413763

    Description: epitope description:GRGGIYRFVTPGER antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  69. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413771

    Description: epitope description:MACMSADLEVVTST antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  70. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413772

    Description: epitope description:MACMSADLEVVTST antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  71. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413781

    Description: epitope description:VPDREVLYREFDEM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  72. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413783

    Description: epitope description:VPDREVLYREFDEM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  73. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413791

    Description: epitope description:FKQKALGLLQTATK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  74. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413793

    Description: epitope description:FKQKALGLLQTATK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  75. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1413799

    Description: epitope description:EAAAPVVESKWRAL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  76. Human respiratory syncytial virus vaccine antigen produced in plants.

    ID: 1476188

    Description: epitope description:FVPCSICSNNPTCWAICKRIP antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:RespiGam

    Publication: 11053254;

  77. Peptide-based candidate vaccine against respiratory syncytial virus.

    ID: 1476241

    Description: epitope description:FVPCSICSNNPTCWAICKRIP antigen name:Major surface glycoprotein G host organism:Mus musculus antibody name:18A2B2

    Publication: 15755607;

  78. Effective synthetic peptide vaccine for foot-and-mouth disease in swine.

    ID: 1476298

    Description: epitope description:NKYSASGSGVRGDFGSLAPRVARQL antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:Guinea pig se...

    Publication: 12057619;

  79. IgE and IgG cross-reactivity among Lol p I and Lol p II/III. Identification of the C-termini of Lol p I, II, and III as cross-reactive structures.

    ID: 1476300

    Description: epitope description:KGGMKNVFDEVIPTAFTVGKTYTPEYN antigen name:Lol p 3 host organism:Oryctolagus cuniculus antibody name:rabbit anti-Lol p I serum

    Publication: 7518655;

  80. IgE and IgG cross-reactivity among Lol p I and Lol p II/III. Identification of the C-termini of Lol p I, II, and III as cross-reactive structures.

    ID: 1476312

    Description: epitope description:EGGTKSEVEDVIPEGWKADTSYSAK antigen name:Lol p 1 host organism:Oryctolagus cuniculus antibody name:rabbit anti-Lol p (LMW) serum

    Publication: 7518655;

  81. Immune responses in mice following immunization with chimeric synthetic peptides representing B and T cell epitopes of measles virus proteins.

    ID: 1476320

    Description: epitope description:INQDPDKILTY antigen name:Fusion glycoprotein F0 host organism:Mus musculus A/J antibody name:mouse serum

    Publication: 1710646;

  82. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476330

    Description: epitope description:HITDDNEEPIAPYHFDLSGHA antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  83. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476332

    Description: epitope description:TDDNEEPIAPYHFDLSGHAFGAMA antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  84. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476334

    Description: epitope description:NEEPIAPYHFDLSGHAFG antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  85. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476337

    Description: epitope description:EQKLRSAGELELQFRRVKC antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  86. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476342

    Description: epitope description:RYTTEGGTKTEAE antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  87. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476351

    Description: epitope description:CFEIKCTKPEACSGEPVVV antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  88. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476353

    Description: epitope description:KCTKPEACSGEPVVVHITDDNEEPIAPYHFDLS antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  89. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476354

    Description: epitope description:KCTKPEACSGEPVVVHITDDNEEPIAPYHFDLS antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  90. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476358

    Description: epitope description:TKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGA antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  91. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476371

    Description: epitope description:TEAEDVIPEGWKADTSYESK antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  92. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476378

    Description: epitope description:TDDNEEPIAPYHFDLSG antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  93. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476389

    Description: epitope description:RYTTEGGTKTEAE antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  94. B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

    ID: 1476390

    Description: epitope description:RYTTEGGTKTEAEDVIPEGWKADTSYESK antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 10428753;

  95. Structural characterisation of sporozoite components for a multistage, multi-epitope, anti-malarial vaccine.

    ID: 1476518

    Description: epitope description:DLFHVNGRDTMNNIVDENKY host organism:Aotus antibody name:Monkey sera

    Publication: 17997122;

  96. Structural characterisation of sporozoite components for a multistage, multi-epitope, anti-malarial vaccine.

    ID: 1476548

    Description: epitope description:TASCGVWDEWSPCSVTCGKGTRS antigen name:Thrombospondin-related anonymous protein, TRAP host organism:Aotus antibody name:Monkey sera

    Publication: 17997122;

  97. Structural characterisation of sporozoite components for a multistage, multi-epitope, anti-malarial vaccine.

    ID: 1476562

    Description: epitope description:SEDRETRPHGRNNENFPYNR host organism:Aotus antibody name:Monkey sera

    Publication: 17997122;

  98. Structural characterisation of sporozoite components for a multistage, multi-epitope, anti-malarial vaccine.

    ID: 1476578

    Description: epitope description:GAATPYAGEPAPGDETLGEE host organism:Aotus antibody name:Monkey sera

    Publication: 17997122;

  99. Structural characterisation of sporozoite components for a multistage, multi-epitope, anti-malarial vaccine.

    ID: 1476581

    Description: epitope description:GAATGYAGEPAPGDETLGEE host organism:Aotus antibody name:Monkey sera

    Publication: 17997122;

  100. Structural characterisation of sporozoite components for a multistage, multi-epitope, anti-malarial vaccine.

    ID: 1476589

    Description: epitope description:GASADYSGEPAPRPETLGEE host organism:Aotus antibody name:Monkey sera

    Publication: 17997122;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston