Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1903959

    Description: epitope description:DTGCAIDISRQELRCG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  2. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1903960

    Description: epitope description:DTGCAIDISRQELRCG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4D2

    Publication: 21940411;

  3. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1903963

    Description: epitope description:RYKYYPETPQGLAKII antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  4. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1903964

    Description: epitope description:RYKYYPETPQGLAKII antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5F8

    Publication: 21940411;

  5. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1903972

    Description: epitope description:KTQNQGPWDEGRVEID antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  6. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1903977

    Description: epitope description:KTQNQGPWDEGRVEID antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1C10

    Publication: 21940411;

  7. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1903988

    Description: epitope description:KECPTQNRAWNSLEVE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  8. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904007

    Description: epitope description:RYKYYPETPQGLAKII antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5F8

    Publication: 21940411;

  9. Identification and mapping of linear antigenic determinants of human amyloid ß(1-42) peptide.

    ID: 1904026

    Description: epitope description:FRHDSGY antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22181818;

  10. Identification and mapping of linear antigenic determinants of human amyloid ß(1-42) peptide.

    ID: 1904027

    Description: epitope description:HHQKLVFFAEDVGSNK antigen name:Amyloid beta A4 protein host organism:Rattus norvegicus Sprague-Dawley

    Publication: 22181818;

  11. Identification and mapping of linear antigenic determinants of human amyloid ß(1-42) peptide.

    ID: 1904030

    Description: epitope description:FAEDVGSNKGAIIGLM antigen name:Amyloid beta A4 protein host organism:Rattus norvegicus Sprague-Dawley

    Publication: 22181818;

  12. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904037

    Description: epitope description:DTGCAIDITRRELKCG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  13. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904039

    Description: epitope description:IHNDVEAWIDRYKYYP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  14. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904050

    Description: epitope description:IHNDVEAWIDRYKYLP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  15. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904056

    Description: epitope description:PRRLTATTEKLEIGWK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  16. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904057

    Description: epitope description:PKRLSMTQEKFEMGWK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  17. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904064

    Description: epitope description:STFVVDGPETAECPNS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  18. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904067

    Description: epitope description:NLAIHSDLSYWIESRF antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  19. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904068

    Description: epitope description:HVTVHSDVSYWIESRY antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  20. Synthetic approach to gain insight into antigenic determinants of cephalosporins: in vitro studies of chemical structure-IgE molecular recognition rel...

    ID: 1904069

    Description: epitope description:cephalosporin host organism:Homo sapiens

    Publication: 21425867;

  21. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904072

    Description: epitope description:KTQSQGPWDEGRVEID antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  22. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904075

    Description: epitope description:KVQVQGPWDEEDIKLD antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  23. Synthetic approach to gain insight into antigenic determinants of cephalosporins: in vitro studies of chemical structure-IgE molecular recognition rel...

    ID: 1904086

    Description: epitope description:cephalosporin host organism:Homo sapiens

    Publication: 21425867;

  24. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904089

    Description: epitope description:NRFEHQMWESVRDELN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21940411;

  25. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904104

    Description: epitope description:DTGCAIDISRQELRCG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4D2

    Publication: 21940411;

  26. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904111

    Description: epitope description:RYKYYPETPQGLAKII antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5F8

    Publication: 21940411;

  27. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904125

    Description: epitope description:NTFVVDGPETKECPTQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4D1

    Publication: 21940411;

  28. Comprehensive mapping of West Nile virus (WNV)- and Japanese encephalitis virus serocomplex-specific linear B-cell epitopes from WNV non-structural pr...

    ID: 1904131

    Description: epitope description:TTESGKLITDWCCRSC antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4D6

    Publication: 21940411;

  29. 3D structure and immunogenicity of Plasmodium falciparum sporozoite induced associated protein peptides as components of fully-protective anti-malaria...

    ID: 1904147

    Description: epitope description:YVLNSKLHNSRSFDKFKWIQ host organism:Aotus antibody name:anti SIAP-1 38166

    Publication: 22115782;

  30. 3D structure and immunogenicity of Plasmodium falciparum sporozoite induced associated protein peptides as components of fully-protective anti-malaria...

    ID: 1904151

    Description: epitope description:LLHYSTISQDNLDISFGELQ host organism:Aotus antibody name:anti SIAP-2 38156

    Publication: 22115782;

  31. HLA-DR3 restricted T cell epitope mimicry in induction of autoimmune response to lupus-associated antigen SmD.

    ID: 1904161

    Description: epitope description:LDIDIDPKVKVATLS antigen name:Galactose/methyl galactoside import ATP-binding protein MglA host organism:Mus musculus HLA-DR3 Tg

    Publication: 21868195;

  32. Mapping of minimal motifs of B-cell epitopes on human zona pellucida glycoprotein-3.

    ID: 1904205

    Description: epitope description:EENW antigen name:Zona pellucida sperm-binding protein 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22162720;

  33. Mapping of minimal motifs of B-cell epitopes on human zona pellucida glycoprotein-3.

    ID: 1904226

    Description: epitope description:SNSWF antigen name:Zona pellucida sperm-binding protein 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22162720;

  34. Structural convergence in the active sites of a family of catalytic antibodies.

    ID: 1904228

    Description: epitope description:4-NITRO-BENZYLPHOSPHONOBUTANOYL-GLYCINE host organism:Mus musculus BALB/c antibody name:D2.3

    Publication: 9027317;

  35. Structural convergence in the active sites of a family of catalytic antibodies.

    ID: 1904231

    Description: epitope description:4-NITRO-BENZYLPHOSPHONOBUTANOYL-GLYCINE host organism:Mus musculus BALB/c antibody name:D2.5

    Publication: 9027317;

  36. Crystal structure of single-domain VL of an anti-DNA binding antibody 3D8 scFv and its active site revealed by complex structures of a small molecule ...

    ID: 1904244

    Description: epitope description:bis-tris host organism:Mus musculus MLR/lpr antibody name:3D8 VL

    Publication: 18338383;

  37. Epitope mapping of Atlantic salmon major allergen by peptide microarray immunoassay.

    ID: 1904272

    Description: epitope description:NDADVAAALAACTAA antigen name:Other Salmo salar (Atlantic salmon) protein host organism:Homo sapiens

    Publication: 21894026;

  38. Epitope mapping of Atlantic salmon major allergen by peptide microarray immunoassay.

    ID: 1904282

    Description: epitope description:DSFNHKAFFAKVGLA antigen name:Other Salmo salar (Atlantic salmon) protein host organism:Homo sapiens

    Publication: 21894026;

  39. Epitope mapping of Atlantic salmon major allergen by peptide microarray immunoassay.

    ID: 1904287

    Description: epitope description:AKVGLASKSSDDVKK antigen name:Other Salmo salar (Atlantic salmon) protein host organism:Homo sapiens

    Publication: 21894026;

  40. Epitope mapping of Atlantic salmon major allergen by peptide microarray immunoassay.

    ID: 1904288

    Description: epitope description:AKVGLASKSSDDVKK antigen name:Other Salmo salar (Atlantic salmon) protein host organism:Homo sapiens

    Publication: 21894026;

  41. Epitope mapping of Atlantic salmon major allergen by peptide microarray immunoassay.

    ID: 1904289

    Description: epitope description:GLASKSSDDVKKAFY antigen name:Other Salmo salar (Atlantic salmon) protein host organism:Homo sapiens

    Publication: 21894026;

  42. Epitope mapping of Atlantic salmon major allergen by peptide microarray immunoassay.

    ID: 1904299

    Description: epitope description:VIDQDKSGFIEEDEL antigen name:Other Salmo salar (Atlantic salmon) protein host organism:Homo sapiens

    Publication: 21894026;

  43. Epitope mapping of Atlantic salmon major allergen by peptide microarray immunoassay.

    ID: 1904302

    Description: epitope description:QDKSGFIEEDELKLF antigen name:Other Salmo salar (Atlantic salmon) protein host organism:Homo sapiens

    Publication: 21894026;

  44. Epitope mapping of Atlantic salmon major allergen by peptide microarray immunoassay.

    ID: 1904306

    Description: epitope description:IEEDELKLFLQNFSA antigen name:Other Salmo salar (Atlantic salmon) protein host organism:Homo sapiens

    Publication: 21894026;

  45. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954771

    Description: epitope description:CCAIRGSFYDLEDIIK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 22970138;

  46. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954775

    Description: epitope description:DIIKGNDLVHDEYTKYI antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 22970138;

  47. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954778

    Description: epitope description:GSSNTNDIDTKRARTD antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 22970138;

  48. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954782

    Description: epitope description:RQLVWDAMQSGVRYAV antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 22970138;

  49. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954785

    Description: epitope description:LCMGVEHIGIAKPQFI antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 22970138;

  50. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954788

    Description: epitope description:EFCEKYTKYFEDMKSK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 22970138;

  51. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954794

    Description: epitope description:RIEWNGMSNYYNKIYR antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 22970138;

  52. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954795

    Description: epitope description:NYYNKIYRKSNKESED antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 22970138;

  53. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954817

    Description: epitope description:VAEREAYYLWKQYNPTGKGIDDANKKAC antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus norvegicus ...

    Publication: 22970138;

  54. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954819

    Description: epitope description:VAEREAYYLWKQYHAHNDTTYLAHK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus norvegicus Wis...

    Publication: 22970138;

  55. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954822

    Description: epitope description:VAEREAYYLWKQYHAHNDTTYLAHK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus norvegicus Wis...

    Publication: 22970138;

  56. Hypoallergenic Der p 1/Der p 2 combination vaccines for immunotherapy of house dust mite allergy.

    ID: 1954828

    Description: epitope description:VGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANI antigen name:Der p 1 host organism:Oryctolagus cuniculus

    Publication: 22789398;

  57. Hypoallergenic Der p 1/Der p 2 combination vaccines for immunotherapy of house dust mite allergy.

    ID: 1954829

    Description: epitope description:VRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL antigen name:Der p 1 host organism:Oryctolagus cuniculus

    Publication: 22789398;

  58. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954839

    Description: epitope description:VAEREAYYLWKQYNPTGKGIDDANKKAC antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus norvegicus ...

    Publication: 22970138;

  59. Hypoallergenic Der p 1/Der p 2 combination vaccines for immunotherapy of house dust mite allergy.

    ID: 1954845

    Description: epitope description:KDLDAFRHYDGRTIIQRDNGYQPNYHAVNIV antigen name:Der p 1 host organism:Oryctolagus cuniculus

    Publication: 22789398;

  60. Hypoallergenic Der p 1/Der p 2 combination vaccines for immunotherapy of house dust mite allergy.

    ID: 1954846

    Description: epitope description:GRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWI antigen name:Der p 1 host organism:Oryctolagus cuniculus

    Publication: 22789398;

  61. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954865

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  62. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954875

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  63. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954877

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  64. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954878

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  65. Highly pathogenic porcine reproductive and respiratory syndrome virus GP5 B antigenic region is not a neutralizing antigenic region.

    ID: 1954888

    Description: epitope description:SHFQLIYNL antigen name:Glycoprotein 5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22771210;

  66. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954901

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  67. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954905

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  68. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954906

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  69. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954907

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  70. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954909

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  71. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954926

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  72. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954929

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  73. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954942

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  74. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954943

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  75. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954945

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  76. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954959

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  77. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955029

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  78. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955030

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  79. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955032

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  80. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955035

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  81. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955036

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  82. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955065

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  83. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955067

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  84. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955094

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  85. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955126

    Description: epitope description:P176 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:CR8033

    Publication: 22878502;

  86. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955136

    Description: epitope description:P176 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:CR8033

    Publication: 22878502;

  87. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955141

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  88. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955142

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  89. Selective neutralization of APP-C99 with monoclonal antibodies reduces the production of Alzheimer's Abeta peptides.

    ID: 1955220

    Description: epitope description:DAEFRHD antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:mC99(1-7)

    Publication: 22317957;

  90. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955231

    Description: epitope description:PGPNITATYG antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  91. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955233

    Description: epitope description:TATYGSKWLE antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  92. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955239

    Description: epitope description:YGSNPRGAAP antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  93. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955247

    Description: epitope description:DVDKPPFDGM antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  94. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955254

    Description: epitope description:DGLGCRACYE antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  95. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955259

    Description: epitope description:IKCKEPVECS antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  96. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955262

    Description: epitope description:GEPVLVKITD antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  97. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955276

    Description: epitope description:QEDKLRKAGE antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  98. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955286

    Description: epitope description:TKITFHIEKG antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  99. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955291

    Description: epitope description:SNDHYLALLV antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  100. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955295

    Description: epitope description:KYAAGDGNIV antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston