Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. B cell responses to a peptide epitope. II: Multiple levels of selection during maturation of primary responses.

    ID: 1511120

    Description: epitope description:DPAF antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:624

    Publication: 9243289;

  2. B cell responses to a peptide epitope. II: Multiple levels of selection during maturation of primary responses.

    ID: 1511122

    Description: epitope description:DPAF antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:627

    Publication: 9243289;

  3. Conformational mimicry of a chlamydial neutralization epitope on filamentous phage.

    ID: 1511131

    Description: epitope description:SAETIFDVTTLNPTIAGSDVAGLQNDPTTN antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 7523368;

  4. Epitopes and active sites of the RecA protein.

    ID: 1511138

    Description: epitope description:TCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALE antigen name:Protein RecA host organism:Mus musculus BALB/c antibody name:ARM321

    Publication: 1692839;

  5. T and B cell epitope mapping of SM23, an integral membrane protein of Schistosoma mansoni.

    ID: 1511178

    Description: epitope description:GAGAYVEVKFSQYGDNLHKVWQAA antigen name:Tetraspanin host organism:Mus musculus C57BL/6

    Publication: 1281197;

  6. Adenovirus type 5 fiber knob binds to MHC class I alpha2 domain at the surface of human epithelial and B lymphoblastoid cells.

    ID: 1511443

    Description: epitope description:LAPISGTVQSAHLIIRFD antigen name:Fiber protein host organism:Mus musculus BALB/c antibody name:1D6.3

    Publication: 9171344;

  7. Adenovirus type 5 fiber knob binds to MHC class I alpha2 domain at the surface of human epithelial and B lymphoblastoid cells.

    ID: 1511467

    Description: epitope description:LIPFNS host organism:Mus musculus BALB/c antibody name:1D6.3

    Publication: 9171344;

  8. Adenovirus type 5 fiber knob binds to MHC class I alpha2 domain at the surface of human epithelial and B lymphoblastoid cells.

    ID: 1511473

    Description: epitope description:HFQYRM host organism:Mus musculus BALB/c antibody name:1D6.3

    Publication: 9171344;

  9. Adenovirus type 5 fiber knob binds to MHC class I alpha2 domain at the surface of human epithelial and B lymphoblastoid cells.

    ID: 1511486

    Description: epitope description:IARLIS host organism:Mus musculus BALB/c antibody name:7A2.7

    Publication: 9171344;

  10. Characterization of intertype specific epitopes on adenovirus hexons.

    ID: 1511526

    Description: epitope description:THLSYKPGKGDE antigen name:Hexon protein host organism:Mus musculus BALB/c

    Publication: 9787653;

  11. Characterization of intertype specific epitopes on adenovirus hexons.

    ID: 1511529

    Description: epitope description:NQAVDSYDPD antigen name:Hexon protein host organism:Mus musculus BALB/c

    Publication: 9787653;

  12. Novel version of Multiple Antigenic Peptide allowing incorporation on a cysteine functionalized lysine tree.

    ID: 1511535

    Description: epitope description:YGVKSSLEDQKIKEKLQPAEIET antigen name:Heat shock 70 kDa protein host organism:Mus musculus BALB/c

    Publication: 1385347;

  13. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511560

    Description: epitope description:EQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  14. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511562

    Description: epitope description:TQEENTERHTTEDVSPS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  15. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511563

    Description: epitope description:NKGKDKDVNAGTSGTHT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  16. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511569

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  17. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511570

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  18. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511575

    Description: epitope description:NKGKDKDVNAGTSGTHT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  19. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511577

    Description: epitope description:APQQIDISNTRATQSQFD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  20. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511579

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston