Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1691673

    Description: epitope description:ISDAMKKVGRKGVITVKD antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New ...

    Publication: 12702515;

  2. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1691676

    Description: epitope description:ISKGANPVEIRRGVMLAV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New ...

    Publication: 12702515;

  3. Molecular and structural properties of three autoimmune IgG monoclonal antibodies to histone H2B.

    ID: 1691686

    Description: epitope description:PEPAKSAPAPKKG antigen name:Histone H2B type 1 host organism:Mus musculus MLR/lpr antibody name:PR1-1, LG2-2

    Publication: 10788471;

  4. Molecular and structural properties of three autoimmune IgG monoclonal antibodies to histone H2B.

    ID: 1691688

    Description: epitope description:PEPAKSAPAPKKG antigen name:Histone H2B type 1 host organism:Mus musculus MLR/lpr antibody name:PR1-1, LG2-2

    Publication: 10788471;

  5. Immunization of mice with human 60-kd Ro peptides results in epitope spreading if the peptides are highly homologous between human and mouse.

    ID: 1691707

    Description: epitope description:VAFSDEMVPCPVTTDM antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus BALB/c

    Publication: 10323459;

  6. Immunization of mice with human 60-kd Ro peptides results in epitope spreading if the peptides are highly homologous between human and mouse.

    ID: 1691710

    Description: epitope description:AIALREYRKKMDIPA antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus BALB/c

    Publication: 10323459;

  7. Immunization of mice with human 60-kd Ro peptides results in epitope spreading if the peptides are highly homologous between human and mouse.

    ID: 1691711

    Description: epitope description:AIALREYRKKMDIPA antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus BALB/c

    Publication: 10323459;

  8. Immunization of mice with human 60-kd Ro peptides results in epitope spreading if the peptides are highly homologous between human and mouse.

    ID: 1691713

    Description: epitope description:AIALREYRKKMDIPA antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus BALB/c

    Publication: 10323459;

  9. An epitope on Ki antigen recognized by autoantibodies from lupus patients shows homology with the SV40 large T antigen nuclear localization signal.

    ID: 1691715

    Description: epitope description:LDGPTYKRRLDECEE antigen name:Proteasome subunit beta type-3 host organism:Homo sapiens

    Publication: 8639183;

  10. An epitope on Ki antigen recognized by autoantibodies from lupus patients shows homology with the SV40 large T antigen nuclear localization signal.

    ID: 1691720

    Description: epitope description:VANFFPKKLL antigen name:Proteasome activator complex subunit 3 host organism:Homo sapiens

    Publication: 8639183;

  11. Mapping of SLE-specific Sm B cell epitopes using murine monoclonal antibodies.

    ID: 1691743

    Description: epitope description:PKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Mus musculus MLR/lpr antibody...

    Publication: 9185874;

  12. Mapping of SLE-specific Sm B cell epitopes using murine monoclonal antibodies.

    ID: 1691744

    Description: epitope description:PKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Mus musculus MLR/lpr antibody...

    Publication: 9185874;

  13. Autoimmunity to RNA polymerase II is focused at the carboxyl terminal domain of the large subunit.

    ID: 1691745

    Description: epitope description:YSPTSPS antigen name:DNA-directed RNA polymerase II subunit RPB1 host organism:Homo sapiens

    Publication: 8912511;

  14. Idiotype-anti-idiotype circuit in non-autoimmune mice after immunization with the epitope and complementary epitope 289-308aa of La/SSB: implications ...

    ID: 1691755

    Description: epitope description:NNGNLQLRKEVTWEVLEG antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus BALB/c

    Publication: 12892732;

  15. Idiotype-anti-idiotype circuit in non-autoimmune mice after immunization with the epitope and complementary epitope 289-308aa of La/SSB: implications ...

    ID: 1691764

    Description: epitope description:NNGNLQLRKEVTWEVLEG antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus BALB/c

    Publication: 12892732;

  16. Idiotype-anti-idiotype circuit in non-autoimmune mice after immunization with the epitope and complementary epitope 289-308aa of La/SSB: implications ...

    ID: 1691771

    Description: epitope description:GSGKGKVQFQGKKTKF antigen name:Lupus La protein host organism:Mus musculus BALB/c

    Publication: 12892732;

  17. Production and characterization of a human monoclonal anti-idiotype to anti-ribosomal P antibodies.

    ID: 1691786

    Description: epitope description:KKEEKKEESEEEDEDMGFGLFD antigen name:Artemia franciscana protein host organism:Homo sapiens

    Publication: 15639646;

  18. Anti-Ro fine specificity defined by multiple antigenic peptides identifies components of tertiary epitopes.

    ID: 1691801

    Description: epitope description:SQEGRTTKQ antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 9328126;

  19. Anti-Ro fine specificity defined by multiple antigenic peptides identifies components of tertiary epitopes.

    ID: 1691805

    Description: epitope description:MWGRALRKAIA antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 9328126;

  20. Anti-Ro fine specificity defined by multiple antigenic peptides identifies components of tertiary epitopes.

    ID: 1691808

    Description: epitope description:VTKYITKGWKEVH antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 9328126;

  21. Anti-Ro fine specificity defined by multiple antigenic peptides identifies components of tertiary epitopes.

    ID: 1691813

    Description: epitope description:ALLRNLGKMTA antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 9328126;

  22. Anti-Ro fine specificity defined by multiple antigenic peptides identifies components of tertiary epitopes.

    ID: 1691814

    Description: epitope description:NEKLLKKARIHPFH antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 9328126;

  23. Anti-Ro fine specificity defined by multiple antigenic peptides identifies components of tertiary epitopes.

    ID: 1691816

    Description: epitope description:AAFYKTFKTV antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 9328126;

  24. T cell help is required to induce idiotypic-anti-idiotypic autoantibody network after immunization with complementary epitope 289-308aa of La/SSB auto...

    ID: 1691825

    Description: epitope description:SFEYFPSHFFVPELEVTIIC host organism:Mus musculus BALB/c

    Publication: 15008973;

  25. Autoepitope-mapping of the U1-70K protein with human-Drosophila chimeric proteins.

    ID: 1691829

    Description: epitope description:GDAFKTLFVARVNYDTTESKLRREFEVYGP antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 9451595;

  26. Sites in myelin basic protein that react with monoclonal antibodies.

    ID: 1691855

    Description: epitope description:ASQKRPSQRHGSKY antigen name:Myelin basic protein host organism:Rattus norvegicus DA antibody name:Rat clone 2.24.17, clone 1.109.1...

    Publication: 2578184;

  27. Sites in myelin basic protein that react with monoclonal antibodies.

    ID: 1691856

    Description: epitope description:ASQKRPSQRHGSKY antigen name:Myelin basic protein host organism:Rattus norvegicus DA antibody name:Rat clone 2.24.17, clone 1.109.1...

    Publication: 2578184;

  28. Sites in myelin basic protein that react with monoclonal antibodies.

    ID: 1691858

    Description: epitope description:ASQKRPSQRHGSKY antigen name:Myelin basic protein host organism:Rattus norvegicus DA antibody name:Rat clone 2.24.17, clone 1.109.1...

    Publication: 2578184;

  29. Sites in myelin basic protein that react with monoclonal antibodies.

    ID: 1691871

    Description: epitope description:SRFSWGAE antigen name:Myelin basic protein host organism:Rattus norvegicus DA antibody name:Rat clone 2.204.2

    Publication: 2578184;

  30. Cross-reactivity in murine fluoroquinolone photoallergy: exclusive usage of TCR Vbeta13 by immune T cells that recognize fluoroquinolone-photomodified...

    ID: 1691884

    Description: epitope description:ciprofloxacin hydrochloride (anhydrous) host organism:Mus musculus BALB/c antibody name:ST-Q-9

    Publication: 9558073;

  31. Cross-reactivity in murine fluoroquinolone photoallergy: exclusive usage of TCR Vbeta13 by immune T cells that recognize fluoroquinolone-photomodified...

    ID: 1691887

    Description: epitope description:norfloxacin host organism:Mus musculus BALB/c antibody name:ST-Q-9

    Publication: 9558073;

  32. Fine epitope mapping of the human SS-B/La protein. Identification of a distinct autoepitope homologous to a viral gag polyprotein.

    ID: 1692022

    Description: epitope description:DLLILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEED antigen name:Lupus La protein host organism:Homo sapiens

    Publication: 1692037;

  33. Autoantibody repertoire to Ro/SSA and La/SSB antigens in patients with primary and secondary Sjögren's syndrome.

    ID: 1692072

    Description: epitope description:KALSVETEKLLKYLEAVEKV antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 8864830;

  34. Autoantibody repertoire to Ro/SSA and La/SSB antigens in patients with primary and secondary Sjögren's syndrome.

    ID: 1692073

    Description: epitope description:LKYLEAVEKVKRTKDELEVI antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 8864830;

  35. Autoantibody repertoire to Ro/SSA and La/SSB antigens in patients with primary and secondary Sjögren's syndrome.

    ID: 1692076

    Description: epitope description:EHLLTNHLKSKEVWKALLQE antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 8864830;

  36. Autoantibody repertoire to Ro/SSA and La/SSB antigens in patients with primary and secondary Sjögren's syndrome.

    ID: 1692078

    Description: epitope description:GKMTANSDVEPGNSEVSLVC antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 8864830;

  37. Autoantigenic epitopes of the B and D polypeptides of the U1 snRNP. Analysis of domains recognized by the Y12 monoclonal anti-Sm antibody and by patie...

    ID: 1692092

    Description: epitope description:MGRGAPPPGMMG antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Homo sapiens

    Publication: 7682245;

  38. The effect of phosphorylation and site-specific mutations in the immunodominant epitope of the human ribosomal P proteins.

    ID: 1692107

    Description: epitope description:SDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 8050201;

  39. Generation of neutralizing monoclonal antibodies against Enterovirus 71 using synthetic peptides.

    ID: 1692116

    Description: epitope description:PESRESLAWQTATNP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:14F9, 18A12, 20E11

    Publication: 19799860;

  40. Generation of neutralizing monoclonal antibodies against Enterovirus 71 using synthetic peptides.

    ID: 1692123

    Description: epitope description:PESRESLAWQTATNP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:14F9, 18A12, 20E11

    Publication: 19799860;

  41. Generation of neutralizing monoclonal antibodies against Enterovirus 71 using synthetic peptides.

    ID: 1692133

    Description: epitope description:YPTFGEHKQEKDLEY antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:22A12

    Publication: 19799860;

  42. Involvement of molecular mimicry between human T-cell leukemia virus type 1 gp46 and osteoprotegerin in induction of hypercalcemia.

    ID: 1692139

    Description: epitope description:SNLDHILEPSIP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 19134004;

  43. A human monoclonal IgM lambda specific for an epitope shared by the 200 kDa neurofilament protein, histones and ribosomal proteins.

    ID: 1692311

    Description: epitope description:AKSPEKAK antigen name:Neurofilament heavy polypeptide host organism:Homo sapiens

    Publication: 8824715;

  44. Sera from JRA patients contain antibodies against a defined epitope in chromosomal protein HMG-17.

    ID: 1692315

    Description: epitope description:PKRKAEGDAKDGKAK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

    Publication: 7517709;

  45. Human autoantibodies reactive with synthetic autoantigens from T-cell receptor beta chain.

    ID: 1692317

    Description: epitope description:KIQPSEPRDSAVYFCA antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 1565623;

  46. Human autoantibodies reactive with synthetic autoantigens from T-cell receptor beta chain.

    ID: 1692318

    Description: epitope description:QPLKEQPALNDSRYCL antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 1565623;

  47. B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

    ID: 1692322

    Description: epitope description:KDKHKDREHRHKEHKKEKDR antigen name:DNA topoisomerase 1 host organism:Homo sapiens

    Publication: 10696071;

  48. B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

    ID: 1692328

    Description: epitope description:SGDAKIKKEKENGFSSPPQI antigen name:DNA topoisomerase 1 host organism:Homo sapiens

    Publication: 10696071;

  49. B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

    ID: 1692334

    Description: epitope description:EDGKLKKPKNKDKDKKVPEP antigen name:DNA topoisomerase 1 host organism:Homo sapiens

    Publication: 10696071;

  50. B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

    ID: 1692335

    Description: epitope description:KDKKVPEPDNKKKKPKKEEE antigen name:DNA topoisomerase 1 host organism:Homo sapiens

    Publication: 10696071;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston